(data stored in ACNUC1104 zone)

EMBL: CP000717.PE613

CP000717.PE613       Location/Qualifiers
FT   CDS_pept        complement(702266..703027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10613"
FT                   /old_locus_tag="TBFG_00605"
FT                   /product="two component system DNA binding transcriptional
FT                   regulatory protein tcrA"
FT                   /note="Mapped to H37Rv Rv0602c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10613"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04956"
FT                   /protein_id="ABR04956.1"
FT                   /translation="MADETTMRAGRGPGRACGRVSGVRILVVEDEPKMTALLARALTEE
FT                   GHTVDTVADGRHAVAAVDGGDYDAVVLDVMLPGIDGFEVCARLRRQRVWTPVLMLTARG
FT                   AVTDRIAGLDGGADDYLTKPFNLDELFARLRALSRRGPIPRPPTLEAGDLRLDPSEHRV
FT                   WRADTEIRLSHKEFTLLEALIRRPGIVHTRAQLLERCWDAAYEARSNIVDVYIRYLRDK
FT                   IDRPFGVTSLETIRGAGYRLRKDGGRHALPR"
     gtggcagatg aaacgacgat gagagctggt cgcggcccgg gccgggcatg cggcagggtg        60
     tcgggtgtgc gcatcctggt ggtcgaggac gagcccaaga tgacggcgct gctggcgcgg       120
     gcgctgaccg aggagggcca cacggtcgac accgttgccg acggccgcca tgcggtggcg       180
     gccgtcgacg gcggtgacta cgacgcggtg gtgctggatg tgatgctgcc cggtatcgac       240
     gggttcgagg tatgcgcgcg gctgcgacgg cagcgggtgt ggacaccggt gctgatgctt       300
     accgcccgcg gcgcggtcac cgaccgcatc gcgggcctag acggcggcgc cgacgattac       360
     ctcaccaaac cgttcaacct cgacgaactg ttcgcccggt tgcgcgcgct gtcacggcgc       420
     gggcccatcc cacgcccacc gacgctggag gccggcgatc tacgcctgga cccgagcgaa       480
     caccgagtct ggcgtgccga caccgaaatc cggctcagtc acaaggaatt caccctgctg       540
     gaagccctga tccgccgtcc cggcatcgtc cacacccgcg cccagctgct ggaacgctgc       600
     tgggacgccg cctacgaggc ccgctccaac atcgtcgacg tctacatccg ctacctgcgc       660
     gacaagatcg accggccctt cggcgtcacc tcgctggaaa ccattcgcgg tgccggatac       720
     cggctgcgca aggacggagg acggcatgcg ctcccccgct ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page