(data stored in ACNUC1104 zone)

EMBL: CP000717.PE618

CP000717.PE618       Location/Qualifiers
FT   CDS_pept        705957..706427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10618"
FT                   /old_locus_tag="TBFG_00610"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0607"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10618"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04961"
FT                   /protein_id="ABR04961.1"
FT                   /translation="MLPGPGARRLTLGIIPEGGAHIDVPRKTVGAWQTADTMGIFQALP
FT                   DVWGGWRTECWEDRFEEQLIRCNGALRLPELDLAAGMDSAREWLRDRIFQRFSDSPAGQ
FT                   ILKLSELLADVGPGLVVSDDAVTNGGARPNNEEWARFVAACDLVRGAHAESA"
     atgctgcccg gtcctggtgc cagacggcta acgctgggca ttatccccga gggcggcgcc        60
     catatcgacg tgccccgaaa gaccgtgggc gcctggcaaa cagccgacac catgggcatc       120
     ttccaggccc ttcccgacgt ctggggcggg tggcggaccg aatgctggga agaccgcttc       180
     gaagagcagc tgattcgatg caacggggcg ctgcggcttc ccgagctgga tttggccgcg       240
     ggcatggaca gcgcccggga gtggctccgt gacaggatat ttcagcgctt ctcggacagc       300
     ccggcaggcc aaattctgaa actctccgag ctgctggccg atgtcggacc cggtctggtc       360
     gtcagcgacg atgccgtgac gaatggcggg gctcgcccaa acaacgaaga gtgggcgcgt       420
     ttcgttgcgg cgtgcgatct ggtgcgtggg gctcacgccg aatcggcctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page