(data stored in ACNUC1104 zone)

EMBL: CP000717.PE621

CP000717.PE621       Location/Qualifiers
FT   CDS_pept        complement(707980..709137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10621"
FT                   /old_locus_tag="TBFG_00613"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0610c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10621"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04964"
FT                   /protein_id="ABR04964.1"
FT                   /translation="MDDELRGLLARYARGELSADDARRAILRYPKWRVAEIDGELETVA
FT                   LDDGTPMLIAESSASDGREYSGLELVRDIAPLVGGLSFDPDEPWGSAFRPGALPELQNW
FT                   ARTVELEDAVAKPGPGQRDLLYEGPWWVAVSPGTGRPAVHRADGLDVITIMTAPDAAAT
FT                   FRRTERHRGLDVVRLGPALWGDLAKRSDFDGVRLNPLRPLAQLWPPHVPAMLVAGCDPR
FT                   PNAEPLPARTVAEIHLWLDQHGARQEKRELSNRATPVGEVTVARAWWNYDRREIAFTRV
FT                   APASDTEGLGSVPSRILCAGKLRQSIQSKLAGLPRLTWRADAWHRQRAALAVGWALELE
FT                   KLVCGERVPFAALRTPEGAHLWHLEPQAFTARAIRKLRDRAASFR"
     atggacgacg agctacgggg cttactggcc cgatatgcgc gcggagaact ctccgccgac        60
     gacgcgcggc gcgcgatact gcgctacccg aagtggcggg tcgccgagat agacggcgaa       120
     ctcgagaccg tggcgctcga tgacggcaca ccgatgctca tcgccgagag ttcggcgtcg       180
     gacggccgcg aatattccgg cctggaactg gttcgcgaca tcgctccgct cgtcggtggc       240
     ctgtcattcg atcccgacga accgtggggt tcggcgttcc ggccgggtgc gctgcccgag       300
     ctgcagaact gggcacgcac ggtcgagctc gaggatgccg ttgccaaacc gggccccggc       360
     cagcgggatt tgctgtacga agggccgtgg tgggttgccg tctccccggg caccggccgg       420
     cccgccgttc accgcgccga cgggttggac gtcatcacga tcatgaccgc gccggacgcg       480
     gcggcgacat tccggcgaac cgagcgacac cgcggactcg acgtcgtgcg gttgggtccc       540
     gcactctggg gcgacctcgc caaacgcagc gacttcgacg gcgttcggct caatccgctg       600
     cgtccactcg cccagctgtg gccgccgcac gtccccgcga tgctggtcgc cggatgcgat       660
     ccgcgcccga acgccgagcc actgcccgcc cgcacggttg ccgaaatcca tctgtggctg       720
     gatcagcatg gggcgcgtca agaaaagcgc gaactgtcca accgtgcgac cccggtcggc       780
     gaggtcaccg tcgcgcgcgc ctggtggaac tacgaccgcc gggagatcgc gttcacccgc       840
     gtcgctccgg cgtccgacac cgaaggtctg ggctcggttc cgtcccggat cctctgcgcc       900
     ggcaaactcc gccaaagcat ccagagcaaa ctcgccggct tgccccggct gacgtggcgc       960
     gctgacgcct ggcaccggca gcgtgccgcc ctggccgtag gctgggcact cgagctggag      1020
     aagctcgtgt gtggtgagcg ggttcctttc gcggcgttgc gcacacctga aggcgcgcac      1080
     ctgtggcatc tggagccgca agcgtttacc gcacgggcga tccgaaagct tcgtgatcgc      1140
     gcggcgtcgt tcaggtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page