(data stored in ACNUC1104 zone)

EMBL: CP000717.PE622

CP000717.PE622       Location/Qualifiers
FT   CDS_pept        complement(709189..709572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10622"
FT                   /old_locus_tag="TBFG_00614"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0611c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10622"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04966"
FT                   /protein_id="ABR04966.1"
FT                   /translation="MPDRPQHPTASRQSSMVSWNHGAAGWLHCVQCGSATNPTACLDWL
FT                   PPIHARSGPMYAEHDVVVLTRDVPDKSLIAGDVGAVVGRYAAGGYEVDFTAANGCTVAV
FT                   VTLAGDDIRPRRRREIPHVREVA"
     ttgccggatc ggccccaaca ccctacggcg tcacggcaat cgtcgatggt gtcgtggaat        60
     cacggtgcgg ccggatggtt gcattgcgta cagtgtggat cagcgacgaa cccgacggcg       120
     tgcctcgatt ggttaccgcc tatccacgct aggagcggac cgatgtacgc agaacacgat       180
     gttgtggtgc taacacggga tgttcccgac aaatccctca tcgccggaga cgtcggtgcc       240
     gtcgtcgggc gctacgccgc gggtggctac gaagtcgact ttaccgccgc gaacggctgc       300
     acggtagcgg tcgtcacgtt ggccggcgac gatatccgac cacgacggcg gcgggagatt       360
     ccgcatgtcc gcgaggtggc gtag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page