(data stored in ACNUC1104 zone)

EMBL: CP000717.PE626

CP000717.PE626       Location/Qualifiers
FT   CDS_pept        713576..713815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10626"
FT                   /old_locus_tag="TBFG_00618"
FT                   /product="hypothetical integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0615"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10626"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04969"
FT                   /protein_id="ABR04969.1"
FT                   /translation="MDVLAAGIAAGALTLAAWGAWRPHYRAASYLVAGAVELALIGLLV
FT                   VTGQTLMAISVAFLVALGGPLVVVNHRRAERSRG"
     atggacgtat tggctgctgg gatcgcggct ggcgcgctca cgctggcggc gtggggcgcc        60
     tggcgcccgc actaccgggc ggcgtcctac ctcgtggccg gtgccgtaga gctggcactg       120
     atcgggctgc tggtggtgac cgggcaaaca ttgatggcca tctcggtggc cttccttgtg       180
     gcgctgggcg gtccgttggt ggtggtcaac caccgcagag ctgaacgcag ccgaggttag       240
//

If you have problems or comments...

PBIL Back to PBIL home page