(data stored in ACNUC1104 zone)

EMBL: CP000717.PE628

CP000717.PE628       Location/Qualifiers
FT   CDS_pept        714234..714635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10628"
FT                   /old_locus_tag="TBFG_00620"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0617"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10628"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04971"
FT                   /protein_id="ABR04971.1"
FT                   /translation="MTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSL
FT                   VRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALSFAGVEVAGVVGHRQVTDAYLAQLA
FT                   RSHDGQLATLDSGLAHLHGDVAVLIPTTT"
     gtgacggtgc tgctcgacgc caacgtgctg atcgcattgg tggtcgccga gcatgtgcat        60
     catgatgccg cagcggactg gctcatggcg tccgacaccg gatttgcgac ctgcccgatg       120
     acacaaggaa gcctggttcg attcctggtg cgctcgggac agtccgcggc ggcggctcgg       180
     gatgtcgtca gtgcggtcca gtgcacgagc cgccacgaat tctggcccga tgcactctct       240
     ttcgccggtg tcgaggtcgc tggtgtggtt gggcaccggc aggtgaccga tgcctacctt       300
     gcccagctcg cgcgaagcca cgacgggcag ttggcgacgc tcgacagcgg cttagcacac       360
     ctgcacggcg acgtcgcggt actcattcca acgaccacct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page