(data stored in ACNUC1104 zone)

EMBL: CP000717.PE63

CP000717.PE63        Location/Qualifiers
FT   CDS_pept        68724..69764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10063"
FT                   /old_locus_tag="TBFG_00064"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0064"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10063"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04406"
FT                   /protein_id="ABR04406.1"
FT                   /translation="METGSPGKRPVLPKRARLLVTAGMGMLALLLFGPRLVDIYVDWLW
FT                   FGEVGFRSVWITVLLTRLAIVAAVALVVAGIVLAALLLAYRSRPFFVPDEPQRDPVAPL
FT                   RSAVMRRPRLFGWGIAVTLGVVCGLIASFDWLKVQLFVHGGTFGIVDPEFGYDIGFFVF
FT                   DLPFYRSVLNWLFVAVVLAFLASLLTHYLFGGLRLTTGRGMLTQAARVQLAVFAGAVVL
FT                   LKAVAYWLDRYELLSSGRKEPTFTGAGYTDIHAELPAKLVLVAIAVLCAVSFFTAIFLR
FT                   DLRIPAMAGRTAGAVGDPGRWTVAAADGAVLGASQRRRCRTPIYPTQHRSDPRGVSDRW
FT                   RLGPVP"
     atggagacag gttcgccggg aaaacgtccg gtcttgccca agcgtgcccg cctgctggtg        60
     acggcaggca tgggcatgct cgcgttgctg ctgtttggac cccggctagt cgatatttac       120
     gttgactggt tgtggtttgg tgaggtcggt ttccgcagcg tctggatcac ggtactgctg       180
     acccgcctgg cgattgtcgc agcggtcgca cttgtggtgg ccggcattgt gcttgctgcc       240
     ctactgctgg cgtatcgctc gcggccgttc tttgtacccg acgagccgca gcgggacccg       300
     gtcgcgccac ttcgcagcgc ggtgatgcgc cggccgcgcc tgttcgggtg gggcatcgcc       360
     gtcacgctcg gtgtggtgtg cgggctgatc gcttcgttcg actggctgaa ggttcagttg       420
     ttcgtacacg ggggcacctt tggcatcgtg gaccccgaat tcggctatga cattgggttt       480
     ttcgtcttcg atctgccgtt ctaccggtcg gtgctgaact ggctgttcgt ggccgtggtt       540
     ctggcgtttc tagcgagcct gttgacgcat tacctgttcg gcggccttcg gctgacaacc       600
     ggcagaggca tgctgaccca ggcagctcgc gttcaactcg cagtgttcgc cggcgcggtt       660
     gtactgctga aggcggttgc ctactggttg gatcgctatg agctgttgtc gagtggacgt       720
     aaggagccga ccttcaccgg cgccggctac accgatatcc acgccgagct gccggccaag       780
     cttgtgctgg tggcgattgc ggtattgtgt gcggtgtcat tctttaccgc gatctttttg       840
     cgcgacttga ggattccggc gatggccggc cgcactgctg gtgctgtcgg cgatcctggt       900
     cggtggactg tggccgctgc tgatggagca gttctcggtg cgtcccaacg ccgccgatgt       960
     cgaacgccca tatatccaac gcaacatcga agcgacccgc gaggcgtatc ggatcggtgg      1020
     cgattgggtc cagtaccgta g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page