(data stored in ACNUC1104 zone)

EMBL: CP000717.PE633

CP000717.PE633       Location/Qualifiers
FT   CDS_pept        718598..719545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10633"
FT                   /old_locus_tag="TBFG_00625"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0622"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10633"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04976"
FT                   /protein_id="ABR04976.1"
FT                   /translation="MSFCVYCGAELADPTRCGACGAYKIGSTWHRTTTPTVGAATTATG
FT                   WRPDPTGRHEGRYFVAGQPTDLVREGDAEAVDPLGQQQLDQSGAVGVSPSAVSGWVRSG
FT                   HRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRESIDDKYLAALRRSGLTGEFNSDANAI
FT                   ARGKQVCRQLQDGGEQQGMPVDQVAVQYYCPQFSDGFHILETITVTGSFTLKDESPNVY
FT                   APAITVSGSGCSGSAGYADIDRGTQVTVKNGQGDILATAFLQAGQGGRFLCTFPFSFEI
FT                   TEGEDRYVVSVSRRGEMSYSFADLKANGLSLVLG"
     atgagtttct gcgtgtattg cggtgccgag cttgccgacc cgaccaggtg cggggcgtgc        60
     ggcgcataca agattggttc aacctggcat cggaccacga cgccgacggt cggcgccgcg       120
     acgacggcaa cgggatggcg acccgatccc accggtcgcc acgagggacg ctacttcgtc       180
     gccgggcagc cgaccgacct cgttcgcgag ggcgacgccg aagccgttga cccacttggt       240
     cagcagcagc tggatcagtc aggtgccgtt ggtgtttcgc cgtcagcggt gtcggggtgg       300
     gtgcgttctg ggcaccgtcg actgtggtgg gcgcttgcgg gcgtggtggc gtttctcggg       360
     ctggtgggag ccggtgtcgt cgggacgctg ttcctgaatc gagaccggga gtccatcgac       420
     gacaagtacc tcgccgcctt gaggcggtcc ggactcaccg gtgagttcaa ctccgacgcg       480
     aacgccatcg cccgcggcaa gcaggtgtgc cgccagttgc aagacggtgg cgaacagcag       540
     gggatgccgg tcgatcaggt cgccgtgcaa tactactgcc cgcagttcag cgatggcttc       600
     catatcctgg aaaccataac tgtcactgga agtttcaccc tcaaggatga atcgccaaac       660
     gtgtacgcac cggcgatcac cgtgtcgggc tccgggtgct cagggtcagc cggctacgcc       720
     gacatcgacc ggggaacgca ggtgacggtg aaaaacggtc agggggacat cctggccacg       780
     gccttcctgc aggcgggtca gggcggccga ttcttgtgca ccttcccttt ctcgtttgaa       840
     atcaccgagg gcgaagaccg ctacgtcgtg tcggtcagtc gtcgaggcga aatgagttac       900
     tcgttcgccg atctgaaggc caatgggcta tcgctcgtct tgggctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page