(data stored in ACNUC1104 zone)

EMBL: CP000717.PE635

CP000717.PE635       Location/Qualifiers
FT   CDS_pept        719892..720287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10635"
FT                   /old_locus_tag="TBFG_00627"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0624"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10635"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04978"
FT                   /protein_id="ABR04978.1"
FT                   /translation="MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVI
FT                   EARFGEPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKGRHRAGLNYGDCFSYG
FT                   LAKISGQPLLFKGEDFQHTDIATVALP"
     atggtgatcg acacgtccgc gctcgttgcg atgctcagcg acgagccaga cgcagagcgg        60
     ttcgaggccg ccgtcgaagc cgaccacatc cggctgatgt cgacggcgtc ttacctggaa       120
     acggcactcg tgatagaagc ccgcttcggt gaaccgggcg gacgtgagct ggatctgtgg       180
     cttcatcgcg ccgcggtcga ccttgttgcc gtgcatgccg accaagcgga tgccgcgcgc       240
     gccgcctacc gcacgtacgg caagggaagg catcgtgcgg ggctcaacta cggcgactgc       300
     ttctcatacg gcctcgccaa gatcagcggc cagccactcc tgttcaaggg cgaagatttc       360
     caacacaccg acatcgccac ggtcgcgctg ccctaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page