(data stored in ACNUC1104 zone)

EMBL: CP000717.PE640

CP000717.PE640       Location/Qualifiers
FT   CDS_pept        complement(723233..724960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10640"
FT                   /old_locus_tag="TBFG_00632"
FT                   /product="exonuclease V alpha subunit recD"
FT                   /note="Mapped to H37Rv Rv0629c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10640"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04983"
FT                   /protein_id="ABR04983.1"
FT                   /translation="MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDE
FT                   RVALAVAVAVRALRAGSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLH
FT                   LYDDRLLYLDRYWREEEQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQ
FT                   GVTVLTGGPGTGKTTTVARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREM
FT                   AKLDATDRARLGDLHAVTLHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMAR
FT                   LAEAVRPGARLILVGDADQLASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGT
FT                   LAEAIRAGDGDAVLGLLRSGEERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVA
FT                   LATLDEHRLLCAHRDGPTGVLHWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLR
FT                   VYNGDTGVVLAGPTGLRAVISGASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVL
FT                   MPQEDSRLLTRELLYTAVTRAKRKVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG"
     gtgaagctca ccgacgtcga ttttgccgtc gaggcctccg ggatggtgcg ggccttcaac        60
     caggccggtg tgctggacgt gtcggatgtg catgtggcgc aacgtctctg tgcactggcc       120
     ggggagagcg acgagcgggt ggcgttggcg gtagcggtgg cggtccgcgc gctacgggcc       180
     ggttcggtgt gtgtggatct gttgtcgatc gcgcgggttg ctggacacga cgacctgccg       240
     tggccggatc cggcggactg gttggcggcg gtgcgggcca gtccgttgct cgccgatcca       300
     cccgtgctgc acctgtatga cgatcggctg ctctatctgg accgctactg gcgcgaagaa       360
     gagcaggtgt gcgcggacct gctcgcgttg ctgacatcca ggcgaccggc cggggtaccc       420
     gacttgcggc gactgttccc gaccggcttt gacgagcagc ggcgcgcggc ggaaatcgcg       480
     ctctcgcaag gtgttacggt gttgactggc gggcctggca ccgggaagac gacgacggtc       540
     gcgcggctgc tggcgttggt tgccgagcag gcggagctgg ccggtgagcc gcggccgcgg       600
     atcgcgctgg ccgcacccac cggcaaggcg gcggcccggc tggccgaggc ggtacggcgc       660
     gagatggcca agctcgacgc caccgaccgg gcacggctcg gcgacctgca cgcggtcacg       720
     ctgcatcgtc tgctgggtgc caaaccggga gcgcggtttc gccaggatcg ccagaaccgg       780
     ttgcctcaca acgtgatcgt ggtcgacgag acctcgatgg tgtcgctgac gctgatggcc       840
     cggctggccg aggcggtgcg cccgggcgcc cggttgatcc tcgtcggcga tgccgaccag       900
     ttggcgtcgg tggaagccgg agcggtgctg gcggatttgg tcgatggctt ctcggtacgc       960
     gacgacgcgc tggtggcgca gctgcgaacg tcgcatcggt tcggcaaggt gatcggtacc      1020
     ttggccgaag cgatccgggc cggcgatggc gatgccgtac tgggcctgct gcgctcgggt      1080
     gaggagcgga tcgagttcgt cgacgacgag gatccggcgc cgcggttgcg cgcggtgctg      1140
     gtgccacacg cgttgcggct gcgcgaggcg gcgctgttgg gtgcctccga cgtcgcgttg      1200
     gccaccctgg acgagcaccg gctgctgtgt gcgcatcggg acgggcccac cggcgtgctg      1260
     cactggaacc gccgggttca agcctggctc gccgaggaga ccggccagcc gccctggacg      1320
     ccgtggtacg ccgggcgtcc gctgctggtg acggccaacg actacggcct tcgcgtctac      1380
     aacggcgaca ccggtgtcgt gctggccggc cccaccggtc tgcgggccgt catttctggt      1440
     gcatccgggc cacttgacgt tgccaccggc cgcctcggcg acgtcgagac catgcacgcg      1500
     atgaccatcc acaagagtca gggcagccag gtcgacgagg tgacggtgct gatgccgcaa      1560
     gaggattcgc ggttgctgac ccgggagttg ctgtacaccg cggtgacccg ggccaaacgc      1620
     aaggtccggg tggtcgggtc cgaagcttcg gtgcgggccg cgatcgcacg ccgggcggtg      1680
     cgggccagcg ggttgcggat gcggttacag tcgacggggt gtggctga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page