(data stored in ACNUC1104 zone)

EMBL: CP000717.PE642

CP000717.PE642       Location/Qualifiers
FT   CDS_pept        complement(728241..731534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10642"
FT                   /old_locus_tag="TBFG_00634"
FT                   /product="exonuclease V gamma subunit recC"
FT                   /note="Mapped to H37Rv Rv0631c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10642"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04985"
FT                   /protein_id="ABR04985.1"
FT                   /translation="MALHLHRAERTDLLADGLGALLADPQPDPFAQELVLVAARGVERW
FT                   LSQRLSLVLGCGPGRADGVCAGIAFRNPQSLIAEITGTLDDDPWSPEALAWPLLAVIDA
FT                   SLDEPWCRTLASHLGHFATTDAEAELRRGRRYSVARRLAGLFASYARQRPGLLAAWLDG
FT                   DLGELPGDLAWQPPLWRALVTTVGADPPHVRHDKTIARLRDGPADLPARLSLFGHTRLA
FT                   CTDVQLLDALAVHHDLHLWLPHPSDELWRALAGFQGADGLLPRRQDTSRRAAQHPLLET
FT                   LGRDVRELQRALPAARATDEFLGATTKPDTLLGWLQADIAGNAPRPAGRSLSDADRSVQ
FT                   VHACHGPARQIDVLREVLLGLLEDDPTLQPRDIVVMCPDIDTYAPLIVAGFGLGEVAGD
FT                   CHPAHRLRVRLADRALTQTNPLLSVAAELLTIAETRATASQLLNLAQAAPVRAKFGFAD
FT                   DDLDTITTWVRESNIRWGFDPTHRRRYGLDTVVHNTWRFGLDRILTGVAMSEDSQAWLD
FT                   TALPLDDVGSNRVELAGMLAEFVERLHHVVGGLSGARPLVAWLDALATGIDLLTACNDG
FT                   WQRAQVQREFADVLARAGSRAAPLLRLPDVRALLDAQLAGRPTRANFRTGTLTVCTMVP
FT                   MRSVPHRVVCLVGLDDGVFPRLSHPDGDDVLAREPMTGERDIRSEDRQLLLDAIGAATQ
FT                   TLVITYTGADERTGQPRPPAVPLAELLDALDQTTSAPVRERILVTHPLQPFDRKNVTPG
FT                   ALLGAKPFTFDPAALAAAQAAAGKRCPPTAFISGRLPAPPAADVTLADLLDFFKDPVKG
FT                   FFRALDYTLPWDVDTVEDSIPVQVDALAEWTVGERMLRDMLRGLHPDDAAHSEWRRGTL
FT                   PPGRLGVRRAKEIRNRARDLAAAALAHRDGHGQAHDVDVDLGDGRRLSGTVTPVFGGRT
FT                   VSVTYSKLAPKHVLPAWIGLVTLAAQEPGREWSALCIGRSKTRNHIARRLFVPPPDPVA
FT                   VLRELVLLYDAGRREPLPLPLKTSCAWAQARRDGQDPYPPARECWQTNRFRPGDDDAPA
FT                   HVRAWGPRAPFEVLLGKPRAGEEVAGEETRLGALAARLWLPLLAAEGSV"
     atggcgcttc acctgcaccg tgccgagcgc accgatctgc ttgccgacgg gctcggcgcg        60
     ctgctggccg atccccagcc cgaccctttc gcgcaggaac tggtgctggt cgctgcccgc       120
     ggcgtggaac gctggctgag ccaacggctt tcgctcgtgt tgggctgcgg gccgggccgc       180
     gccgacgggg tgtgcgccgg catcgcgttc cgcaatccgc agtccctgat cgccgagatc       240
     accggcaccc tcgacgacga cccgtggtcg ccggaagccc tggcgtggcc gctgctggcg       300
     gtgatcgacg ccagcctcga cgaaccgtgg tgccgcacgc tggcatccca cttggggcac       360
     ttcgcgacga ccgatgccga ggcggagctg cgccgcggcc ggcgctattc ggtggcgcgc       420
     cggctagccg ggctgttcgc gtcctatgca cgccagcgtc ccgggttgct ggccgcttgg       480
     ctggacggcg acctcggcga gctgcccggc gacttggcct ggcaaccgcc actgtggcgc       540
     gccctggtga ccacggtcgg ggccgatccc ccgcatgtcc gccacgacaa gaccatcgcc       600
     cggctgcgcg acggccccgc cgacctgccg gctcggcttt cgctgttcgg ccacacccgc       660
     ctggcctgca ccgacgtgca gctgctggat gcgctggccg tccaccacga cctgcacctg       720
     tggctgccgc accccagcga cgagttgtgg cgggcgctgg ccggcttcca gggcgctgat       780
     ggcctgctgc cgcggcggca ggacaccagc cggcgggccg cccagcaccc gctgctggaa       840
     acgctgggcc gcgacgtgcg cgaactgcag cgcgcgctgc ccgccgcccg ggccaccgac       900
     gaattccttg gtgccacaac caaacccgac acgttgctgg gatggctgca agccgacatc       960
     gccggcaacg cgccgcgacc cgccgggcgt agcttgtcgg atgccgaccg atcggtgcag      1020
     gtccatgcct gtcacggccc ggcgcggcaa atcgatgtgc tgcgcgaggt gctgctcggc      1080
     ctcctcgagg acgacccgac gctgcaaccg cgcgacatcg tggtgatgtg ccccgacatc      1140
     gacacctacg caccgttgat cgtcgccggc ttcggcctcg gtgaggtggc cggcgactgc      1200
     caccccgcac accggctgcg ggtgcgtctg gccgaccgcg ccctgaccca gaccaatccg      1260
     ctgctctcgg tggccgccga actgctcacc atcgccgaaa cccgggccac cgccagccaa      1320
     ctgctcaacc tcgcgcaggc cgctccggtg cgcgccaaat tcgggttcgc cgacgacgac      1380
     ctggacacca tcaccacgtg ggtgcgcgaa tcgaacatcc gctggggctt cgacccgacg      1440
     caccggcgac gctatggcct cgacaccgtc gtgcacaaca cgtggcggtt cggactcgac      1500
     cgcatcctca ccggggtggc catgtccgag gattcccaag cgtggctgga taccgcgctg      1560
     ccccttgatg acgtcggcag caatcgggtc gagctggccg ggatgctggc cgagttcgtc      1620
     gaacggttgc atcatgtcgt cggcggactc agcggtgcac ggccgttggt cgcatggctg      1680
     gatgcgctgg ccacggggat cgatctgctg accgcctgta acgacggctg gcaacgcgcg      1740
     caggtgcagc gggagttcgc cgacgtgctg gcgcgcgccg gttcgcgcgc ggcgccgctg      1800
     ttgcggctgc ccgacgtgcg agcgcttttg gacgcgcagc tggccgggcg cccgacccgg      1860
     gccaactttc gcaccggcac gctgaccgtc tgcacgatgg tcccgatgcg ctcggtgccg      1920
     caccgggtgg tgtgcctggt gggtctggac gacggcgtgt ttccgcggct gagccatccc      1980
     gacggggacg acgtgctggc ccgagaaccg atgacgggtg aacgtgacat ccgttcggag      2040
     gaccggcaat tgctgctgga cgcgataggt gcggccaccc agaccctggt gatcacttac      2100
     accggcgccg acgagcgcac cgggcaaccg cgcccacccg cggtgccgct ggccgagttg      2160
     ctcgacgcgc tcgaccagac gacgtcagcg ccggtgcgtg agcggatcct ggtcacacac      2220
     ccactgcagc cgttcgaccg gaagaacgtc acccccggcg cactgctggg cgccaagccg      2280
     ttcacgttcg accccgccgc gctcgccgcc gcccaggccg ccgccgggaa gcgctgtcca      2340
     ccaacggctt tcatctccgg tcggctgccc gcaccacccg cggccgacgt gacgctggcg      2400
     gacctgctcg acttcttcaa ggatccggtc aaggggttct tccgggcgct ggactacacg      2460
     ctgccctggg acgtcgacac cgtcgaggac tcgataccgg tccaggtcga cgccttggcc      2520
     gagtggacgg tgggcgagcg gatgttgcgc gacatgctcc gcggcctgca ccccgacgac      2580
     gccgctcact ccgaatggcg tcgcggcacg ttgccgcccg ggcgcctcgg cgtgcgacgg      2640
     gcgaaggaaa tccggaaccg cgcgcgcgat ctggcggccg ccgcgctggc gcaccgcgac      2700
     ggccacggcc aggcgcacga cgtcgacgtc gacctcggcg acgggcggcg actgagcggc      2760
     acggtgacac ccgtgttcgg cgggcgcacg gtgtcggtga cctactcaaa gctggcgccc      2820
     aagcatgtgt tgccggcgtg gatcggcctg gttacgctgg ccgcccaaga gcctggccgc      2880
     gagtggtcgg cgctgtgcat cggccgcagc aagaccagga accacatcgc cagaaggctt      2940
     ttcgtgccgc cgccggaccc ggtggcggta ttgcgggagc tggtgttgct gtacgacgcc      3000
     ggccggcgcg aaccactgcc gctgccgctg aagacgtcct gcgcgtgggc ccaggcacgc      3060
     cgagacggcc aagaccccta cccgcccgcc cgcgaatgct ggcagaccaa caggttccgg      3120
     ccgggcgacg acgacgcgcc cgcccacgtg cgagcctggg gcccgcgcgc acccttcgag      3180
     gtgttgctcg gcaagccccg cgcgggcgaa gaggtcgccg gggaagagac ccggctaggg      3240
     gcgctggccg cccggctatg gctgccgctg ttggccgccg aagggtcggt ctga            3294
//

If you have problems or comments...

PBIL Back to PBIL home page