(data stored in ACNUC1104 zone)

EMBL: CP000717.PE65

CP000717.PE65        Location/Qualifiers
FT   CDS_pept        71963..72364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10065"
FT                   /old_locus_tag="TBFG_00065"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0065"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10065"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04408"
FT                   /protein_id="ABR04408.1"
FT                   /translation="MDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVG
FT                   HALRRAVLSDEISEEQARAALDALPYLIDNRYPHSPRLIEYTWQLRHNVTFYDALYVAL
FT                   ATALDVPLLTGDSRLAAAPGLPCEIKLVR"
     gtggatgaat gtgtagtcga cgcggcggcc gtggttgacg ctctcgccgg caagggcgcc        60
     agcgcgatcg ttctgcgcgg tttgctcaag gagtcgattt ctaacgcgcc gcatttgctg       120
     gacgcagagg tcggacatgc actccgccgc gccgtgctca gcgacgaaat ctccgaagag       180
     caggctcgcg ccgcgttgga tgccttgcct tatctcatcg acaatcgtta cccgcacagc       240
     ccacgactga tcgaatacac atggcagcta aggcacaacg tcacgttcta cgacgccctt       300
     tacgtcgcac tggccaccgc actggatgtc ccgctgctca cgggcgactc gcggcttgcg       360
     gccgcgccgg gccttccgtg cgaaatcaaa ctcgttcggt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page