(data stored in ACNUC1104 zone)

EMBL: CP000717.PE651

CP000717.PE651       Location/Qualifiers
FT   CDS_pept        736965..737450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10651"
FT                   /old_locus_tag="TBFG_00643"
FT                   /product="preprotein translocase secE1 subunit"
FT                   /note="Mapped to H37Rv Rv0638"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10651"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04994"
FT                   /protein_id="ABR04994.1"
FT                   /translation="MSDEGDVADEAVADGAENADSRGSGGRTALVTKPVVRPQRPTGKR
FT                   SRSRAAGADADVDVEEPSTAASEATGVAKDDSTTKAVSKAARAKKASKPKARSVNPIAF
FT                   VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG"
     gtgagcgacg aaggcgacgt tgccgacgag gccgtagccg acggcgccga gaatgcggac        60
     agccgcggga gcggtggccg gacggccctg gtgacaaagc cggtggtgcg gccgcaacgt       120
     cccaccggca agcggtcgcg gtcgcgtgcg gcaggagccg acgcagacgt cgacgtcgaa       180
     gagccgtcga ccgcggcttc ggaagctacc ggggtcgcca aggacgattc gaccaccaag       240
     gccgtgtcga aggctgccag ggcaaaaaag gccagtaaac cgaaggcccg gtcggttaac       300
     ccgatcgcat tcgtctacaa ctacctcaag caggtcgttg ccgagatgcg gaaggtaatc       360
     tggccgaacc gcaaacaaat gcttacctac acgtcggtgg tgctggcgtt tctggccttc       420
     atggtggcgc tggtcgccgg tgctgacttg ggcctgacca agctggtgat gttggtgttc       480
     ggctga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page