(data stored in ACNUC1104 zone)

EMBL: CP000717.PE653

CP000717.PE653       Location/Qualifiers
FT   CDS_pept        738250..738678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10653"
FT                   /old_locus_tag="TBFG_00645"
FT                   /product="50S ribosomal protein L11 rplK"
FT                   /note="Mapped to H37Rv Rv0640"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10653"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04996"
FT                   /protein_id="ABR04996.1"
FT                   /translation="MAPKKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYN
FT                   AATENQRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVAKVTW
FT                   DQVREIAETKKTDLNANDVDAAAKIIAGTARSMGITVE"
     atggccccga agaagaaggt cgccgggttg atcaagctgc agatcgtggc gggccaggcc        60
     aaccctgccc cgccagtggg ccccgcgctc ggtcagcacg gcgtcaacat catggagttc       120
     tgcaaggcgt acaacgccgc gacggagaac cagcgcggca acgtcatccc ggtggagatc       180
     accgtttatg aagaccgtag cttcactttc acgctgaaga cgccgcccgc cgccaagctg       240
     ctgcttaagg ccgctggtgt ggcgaagggt tcggcggagc cgcacaagac caaggtcgcc       300
     aaagtcacct gggatcaagt ccgcgaaatc gccgagacca agaagacgga cctcaacgcc       360
     aacgacgtcg acgctgcggc caagatcatc gccggtaccg ctcggtcgat gggcatcacc       420
     gtcgaatag                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page