(data stored in ACNUC1104 zone)

EMBL: CP000717.PE662

CP000717.PE662       Location/Qualifiers
FT   CDS_pept        750124..750798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10662"
FT                   /old_locus_tag="TBFG_00654"
FT                   /product="malonyl CoA-acyl carrier protein transacylase
FT                   fabD2"
FT                   /note="Mapped to H37Rv Rv0649"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10662"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05005"
FT                   /protein_id="ABR05005.1"
FT                   /translation="MSGRSRLPGSSSRRDAARIVAERVVATVAGVAVAVDEVDAAEARL
FT                   RDGPRAAALPASGTSEGRQLRRWLTQLIVTERVVAAEAAARGLTAAGAPAEADLLPDAT
FT                   ARLEIGSVAAAVLADPLARALFAAVTARVAVTDDAVADYHARNPLRFAAPCPGQHGWRA
FT                   PAAAAPPLDQVRRAITEHLLGAARRRAFRVWLDARRNALVVLAPGYEHPGDPRQPDNTR
FT                   RH"
     atgagcgggc gaagccgatt gcccggctcc tcctcacgcc gcgacgcggc gcgcatcgtc        60
     gccgagcggg tggtcgcgac cgtcgccggt gtcgcggtag cggtcgacga ggtcgacgcg       120
     gccgaagcgc ggctgcgcga cggaccgcgc gcggccgcgc tgccggcgag cggcaccagc       180
     gagggacgcc aactgcggcg ctggctcacc caactgatcg tgaccgagcg ggtggtagcc       240
     gccgaggccg ccgcacgtgg tctgaccgcg gcgggcgccc ccgccgaggc ggacctgctg       300
     cccgacgcga cggctcggct ggagatcggc agcgtcgccg ccgcggtgct ggcggatcct       360
     ttggcgcggg cgttgttcgc cgccgtcacc gcgcgggtcg cggtcaccga cgacgccgtg       420
     gccgactacc atgcccgcaa cccgctgcgg ttcgccgcgc catgtcccgg ccagcacggc       480
     tggcgtgccc cggcggcggc cgccccaccg ctggatcagg tgcgccgcgc gatcaccgag       540
     catctgttgg gggccgcgcg ccgccgcgcc ttccgggtgt ggctggacgc gcgccggaac       600
     gccctggtgg tgctggcccc cggctatgag caccccggcg acccgcgcca acccgacaac       660
     acccgccggc actga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page