(data stored in ACNUC1104 zone)

EMBL: CP000717.PE664

CP000717.PE664       Location/Qualifiers
FT   CDS_pept        752037..752573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10664"
FT                   /old_locus_tag="TBFG_00656"
FT                   /product="50S ribosomal protein L10 rplJ"
FT                   /note="Mapped to H37Rv Rv0651"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10664"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05007"
FT                   /protein_id="ABR05007.1"
FT                   /translation="MARADKATAVADIAAQFKESTATLITEYRGLTVANLAELRRSLTG
FT                   SATYAVAKNTLIKRAASEAGIEGLDELFVGPTAIAFVTGEPVDAAKAIKTFAKEHKALV
FT                   IKGGYMDGHPLTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGLFNAPASQLARLAA
FT                   ALQEKKACPGPDSAE"
     atggccaggg ctgacaaggc caccgccgtc gcagacatcg cagcgcagtt caaggagtcg        60
     accgcgacgt tgatcaccga ataccgcggc ttgacggtgg ccaacctggc cgagctacgc       120
     aggtctctga cggggtcggc gacctacgcg gtggccaaaa acacactcat caagcgggcg       180
     gcctccgagg ccggcatcga gggcctcgac gaactgtttg tgggccccac cgcgatcgcg       240
     ttcgtcaccg gtgagccggt cgacgccgcc aaggccatca agaccttcgc caaggagcac       300
     aaggcgctgg tcatcaaggg cggctacatg gacggccacc cattgaccgt ggccgaagtc       360
     gagcgcatcg ccgacctgga gtcccgcgag gtgttactgg ccaagctggc cggtgcgatg       420
     aagggcaacc tggccaaggc ggccgggttg ttcaacgcgc cggcctcgca gctggcccgg       480
     ctcgcggccg ccctgcagga aaagaaggcc tgcccaggcc cagactcagc cgagtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page