(data stored in ACNUC1104 zone)

EMBL: CP000717.PE669

CP000717.PE669       Location/Qualifiers
FT   CDS_pept        complement(756745..757128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10669"
FT                   /old_locus_tag="TBFG_00661"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0656c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10669"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05012"
FT                   /protein_id="ABR05012.1"
FT                   /translation="MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQM
FT                   SRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVGALSVVDLLICDTAAARGLVVLHDD
FT                   ADYELAERHLPDIRVRRVVSADD"
     ttggcggctg caacgacaac cggaacccac cgaggcctgg aactccgcgc tgctcagcgg        60
     gccgtcgggt cgtgcgaacc gcaacgagcc gagttctgcc gatcagcgcg gaatgcggac       120
     gagttcgacc agatgagccg gatgtttggt gacgtctacc ccgatgtgcc agtgccgaaa       180
     tccgtgtggc ggtggatcga ttcggcacag caccgcctcg cccgggcggg agcggtgggt       240
     gccctgtcgg ttgtcgatct gctgatctgc gacactgcgg cggccagggg cctagtagtc       300
     ctccacgacg atgccgacta cgaactcgca gagcgtcacc ttcccgacat cagagtgcgg       360
     agggtcgtca gcgccgacga ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page