(data stored in ACNUC1104 zone)

EMBL: CP000717.PE67

CP000717.PE67        Location/Qualifiers
FT   CDS_pept        complement(74771..75340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10067"
FT                   /old_locus_tag="TBFG_00067"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0067c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10067"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04410"
FT                   /protein_id="ABR04410.1"
FT                   /translation="MAPTDRRVRADAARNRARVLEVAYQTFAADGLSVPVDEIARRAGV
FT                   GAGTVYRHFPTKEALFQAVIADRMHRIIDKGHALLKSKHPGDALFAFLRSMVLQWGATD
FT                   RGLVEALAGVGIEISSAAPEAEADFLDLLTDLLRAAQRAGTVRPDVDVLEVKTLLVGCQ
FT                   AMQSYNAELAAKVTDVALDGLRANRK"
     ttggctccta ctgaccggcg ggtgcgtgcc gacgcggccc gtaaccgggc acgcgtattg        60
     gaggttgcct accaaacctt tgcggccgac ggtctatcgg tgcccgttga cgagatcgct       120
     cggcgcgccg gagtcggcgc aggcacggta taccggcatt tcccgaccaa ggaggcgctg       180
     tttcaggcgg tgatcgccga ccggatgcac cgcatcatcg acaagggaca tgccctgctc       240
     aaatccaagc atcccggcga cgcgctgttt gcattcctgc ggtcgatggt attgcagtgg       300
     ggcgccaccg atcgcggcct ggtcgaggcg ctggccggcg tcgggattga aatcagcagc       360
     gcggccccgg aagccgaggc agatttcttg gacctgctca ccgacctgtt gcgcgccgcc       420
     cagcgcgccg gcaccgtacg gccggacgta gacgtgcttg aagtcaagac gctcctagtc       480
     ggctgccaag cgatgcagag ctacaacgct gagttggccg caaaggtgac cgacgtcgcc       540
     ctcgacggcc ttcgggcaaa cagaaagtga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page