(data stored in ACNUC1104 zone)

EMBL: CP000717.PE672

CP000717.PE672       Location/Qualifiers
FT   CDS_pept        complement(758446..758754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10672"
FT                   /old_locus_tag="TBFG_00663"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0659c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10672"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05015"
FT                   /protein_id="ABR05015.1"
FT                   /translation="MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGL
FT                   VSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRRITRLSPARLHEACQTLRASTGC"
     atgcggcgcg gtgaattgtg gtttgccgcc acacctggtg gtgacagacc agtacttgtc        60
     cttaccagag atccggtggc agaccgcatc ggcgcggtcg ttgtggtggc cctaacccgc       120
     acccgccgag gcctggtgtc ggaattggag ctcacggccg tcgaaaaccg tgttccgagc       180
     gactgcgtcg tcaacttcga caacattcat acgttgccac gcaccgcatt ccgacgccgc       240
     atcacccggc tgtccccggc ccgcctgcac gaagcctgtc aaacactccg ggcgagcacg       300
     gggtgttga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page