(data stored in ACNUC1104 zone)

EMBL: CP000717.PE673

CP000717.PE673       Location/Qualifiers
FT   CDS_pept        complement(758741..758986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10673"
FT                   /old_locus_tag="TBFG_00664"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0660c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10673"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05016"
FT                   /protein_id="ABR05016.1"
FT                   /translation="MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQD
FT                   VQAYTERPLTDDENALAEIADWGPAEDWADWADAAR"
     atgctcagct tccgcgccga cgaccacgac gtcgacctgg ccgacgcgtg ggcgcgtcgc        60
     ctacacatcg gccgctccga gctgctgcgc gatgcgctgc gacgtcactt ggccgcgctg       120
     gccgcggacc aggatgtcca ggcctacacc gagcgaccgt tgacggacga cgagaacgca       180
     ctggctgaga tcgccgactg ggggccggcg gaggactggg ccgactgggc cgatgcggcg       240
     cggtga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page