(data stored in ACNUC1104 zone)

EMBL: CP000717.PE674

CP000717.PE674       Location/Qualifiers
FT   CDS_pept        complement(759096..759533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10674"
FT                   /old_locus_tag="TBFG_00665"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0661c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10674"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05017"
FT                   /protein_id="ABR05017.1"
FT                   /translation="MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQ
FT                   EFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIEATSKRGLTLFETTPGLEACDAVLA
FT                   AVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR"
     atgatagtgc tcgacaccac cgtcctcgtc tatgccaaag gcgccgagca tccactccgc        60
     gatccctgcc gcgatctcgt cgcggcaatc gccgacgaac gcatcgctgc gaccaccacc       120
     gccgaggtga tccaggagtt cgtccacgta cgcgcccgcc ggcgcgaccg cagcgacgcc       180
     gccgcgctgg gccgtgtgac tatgccgaac tgctctcgcc gctactcacc atcaatcgag       240
     gccacctcga agcgcggcct gacgctgttc gagacaacgc cagggcttga agcctgcgac       300
     gcggtgctcg cggcggttgc cgcaagcgcc ggcgcgaccg ctcttgtctc ggctgacccg       360
     gcgttcgccg atctgtcgga tgtcgtgcac gtcattcccg acgcggccgg gatggtcagc       420
     ctgctcggcg accgctga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page