(data stored in ACNUC1104 zone)

EMBL: CP000717.PE682

CP000717.PE682       Location/Qualifiers
FT   CDS_pept        767131..771081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10682"
FT                   /old_locus_tag="TBFG_00670"
FT                   /product="DNA-directed RNA polymerase beta subunit rpoC"
FT                   /note="Mapped to H37Rv Rv0668"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10682"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05025"
FT                   /protein_id="ABR05025.1"
FT                   /translation="MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDG
FT                   LFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVE
FT                   DQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDI
FT                   WSTFTKLAPKQLIVDENLYRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVI
FT                   RNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMK
FT                   RLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLV
FT                   EGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILSPASGRPLAM
FT                   PRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKV
FT                   RLTQLRPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQA
FT                   AIINDLAERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPRKKEILDHYEERA
FT                   DKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPIITIVDSGATGNFT
FT                   QTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSG
FT                   YLTRRLVDVSQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAV
FT                   DEAGNVIVERGQDLGDPEIDALLAAGITQVKVRSVLTCATSTGVCATCYGRSMATGKLV
FT                   DIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVPRGKAPIAD
FT                   VTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEV
FT                   GQQLMEGSADPHEVLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVT
FT                   IIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEPAAGRPVLMGITKASLATDSWLSAAS
FT                   FQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARAAAYT
FT                   IPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR"
     gtgctcgacg tcaacttctt cgatgaactc cgcatcggtc ttgctaccgc ggaggacatc        60
     aggcaatggt cctatggcga ggtcaaaaag ccggagacga tcaactaccg cacgcttaag       120
     ccggagaagg acggcctgtt ctgcgagaag atcttcgggc cgactcgcga ctgggaatgc       180
     tactgcggca agtacaagcg ggtgcgcttc aagggcatca tctgcgagcg ctgcggcgtc       240
     gaggtgaccc gcgccaaggt gcgtcgtgag cggatgggcc acatcgagct tgccgcgccc       300
     gtcacccaca tctggtactt caagggtgtg ccctcgcggc tggggtatct gctggacctg       360
     gccccgaagg acctggagaa gatcatctac ttcgctgcct acgtgatcac ctcggtcgac       420
     gaggagatgc gccacaatga gctctccacg ctcgaggccg aaatggcggt ggagcgcaag       480
     gccgtcgaag accagcgcga cggcgaacta gaggcccggg cgcaaaagct ggaggccgac       540
     ctggccgagc tggaggccga gggcgccaag gccgatgcgc ggcgcaaggt tcgcgacggc       600
     ggcgagcgcg agatgcgcca gatccgtgac cgcgcgcagc gtgagctgga ccggttggag       660
     gacatctgga gcactttcac caagctggcg cccaagcagc tgatcgtcga cgaaaacctc       720
     taccgcgaac tcgtcgaccg ctacggcgag tacttcaccg gtgccatggg cgcggagtcg       780
     atccagaagc tgatcgagaa cttcgacatc gacgccgaag ccgagtcgct gcgggatgtc       840
     atccgaaacg gcaaggggca gaagaagctt cgcgccctca agcggctgaa ggtggttgcg       900
     gcgttccaac agtcgggcaa ctcgccgatg ggcatggtgc tcgacgccgt cccggtgatc       960
     ccgccggagc tgcgcccgat ggtgcagctc gacggcggcc ggttcgccac gtccgacttg      1020
     aacgacctgt accgcagggt gatcaaccgc aacaaccggc tgaaaaggct gatcgatctg      1080
     ggtgcgccgg aaatcatcgt caacaacgag aagcggatgc tgcaggaatc cgtggacgcg      1140
     ctgttcgaca atggccgccg cggccggccc gtcaccgggc cgggcaaccg tccgctcaag      1200
     tcgctttccg atctgctcaa gggcaagcag ggccggttcc ggcagaacct gctcggcaag      1260
     cgtgtcgact actcgggccg gtcggtcatc gtggtcggcc cgcagctcaa gctgcaccag      1320
     tgcggtctgc ccaagctgat ggcgctggag ctgttcaagc cgttcgtgat gaagcggctg      1380
     gtggacctca accatgcgca gaacatcaag agcgccaagc gcatggtgga gcgccagcgc      1440
     ccccaagtgt gggatgtgct cgaagaggtc atcgccgagc acccggtgtt gctgaaccgc      1500
     gcacccaccc tgcaccggtt gggtatccag gccttcgagc caatgctggt ggaaggcaag      1560
     gccattcagc tgcacccgtt ggtgtgtgag gcgttcaatg ccgacttcga cggtgaccag      1620
     atggcggtgc acctgccttt gagcgccgaa gcgcaggccg aggctcgcat tttgatgttg      1680
     tcctccaaca acatcctgtc gccggcatct gggcgtccgt tggccatgcc gcggctggac      1740
     atggtgaccg ggctgtacta cctgaccacc gaggtccccg gggacaccgg cgaataccag      1800
     ccggccagcg gggatcaccc ggagactggt gtctactctt cgccggccga agcgatcatg      1860
     gcggccgacc gcggtgtctt gagcgtgcgg gccaagatca aggtgcggct gacccagctg      1920
     cggccgccgg tcgagatcga ggccgagcta ttcggccaca gcggctggca gccgggcgat      1980
     gcgtggatgg ccgagaccac gctgggccgg gtgatgttca acgagctgct gccgctgggt      2040
     tatccgttcg tcaacaagca gatgcacaag aaggtgcagg ccgccatcat caacgacctg      2100
     gccgagcgtt acccgatgat cgtggtcgcc cagaccgtcg acaagctcaa ggacgccggc      2160
     ttctactggg ccacccgcag cggcgtgacg gtgtcgatgg ccgacgtgct ggtgccgccg      2220
     cgcaagaagg agatcctcga ccactacgag gagcgcgcgg acaaggtcga aaagcagttc      2280
     cagcgtggcg ctttgaacca cgacgagcgc aacgaggcgc tggtggagat ttggaaggaa      2340
     gccaccgacg aggtcggtca ggcgttgcgg gagcactacc ccgacgacaa cccgatcatc      2400
     accatcgtcg actccggcgc caccggcaac ttcacccaga ctcgaacgct ggccggtatg      2460
     aagggcctgg tgaccaaccc gaagggtgag ttcatcccgc gtccggtcaa gtcctccttc      2520
     cgtgagggcc tgaccgtgct ggagtacttc atcaacaccc acggcgctcg aaagggcttg      2580
     gcggacaccg cgttgcgcac cgccgactcc ggctacctga cccgacgtct ggtggacgtg      2640
     tcccaggacg tgatcgtgcg cgagcacgac tgccagaccg agcgcggcat cgtcgtcgag      2700
     ctggccgagc gtgcacccga cggcacgctg atccgcgacc cgtacatcga aacctcggcc      2760
     tacgcgcgga ccctgggcac cgacgcggtc gacgaggccg gcaacgtcat cgtcgagcgt      2820
     ggtcaagacc tgggcgatcc ggagattgac gctctgttgg ctgctggtat tacccaggtc      2880
     aaggtgcgtt cggtgctgac gtgtgccacc agcaccggcg tgtgcgcgac ctgctacggg      2940
     cgttccatgg ccaccggcaa gctggtcgac atcggtgaag ccgtcggcat cgtggccgcc      3000
     cagtccatcg gcgaacccgg cacccagctg accatgcgca ccttccacca gggtggcgtc      3060
     ggtgaggaca tcaccggtgg tctgccccgg gtgcaggagc tgttcgaggc ccgggtaccg      3120
     cgtggcaagg cgccgatcgc cgacgtcacc ggccgggttc ggctcgagga cggcgagcgg      3180
     ttctacaaga tcaccatcgt tcctgacgac ggcggtgagg aagtggtcta cgacaagatc      3240
     tccaagcggc agcggctgcg ggtgttcaag cacgaagacg gttccgaacg ggtgctctcc      3300
     gatggcgacc acgtcgaggt gggccagcag ctgatggaag gctcggccga cccgcatgag      3360
     gtgctgcggg tgcagggccc ccgcgaggtg cagatacacc tggttcgcga ggtccaggag      3420
     gtctaccgcg cccaaggtgt gtcgatccac gacaagcaca tcgaggtgat cgttcgccag      3480
     atgctgcgcc gggtgaccat catcgactcg ggctcgacgg agtttttgcc tggctcgctg      3540
     atcgaccgcg cggagttcga ggcagagaac cgccgagtgg tggccgaggg cggtgagccc      3600
     gcggccggcc gtccggtgct gatgggcatc acgaaggcgt cgctggccac cgactcgtgg      3660
     ctgtcggcgg cgtcgttcca ggagaccact cgcgtgctga ccgatgcggc gatcaactgc      3720
     cgcagcgata agctcaacgg tctgaaggaa aacgtgatca tcggcaagct gatcccggcc      3780
     ggtaccggta tcaaccgcta ccgcaacatc gcggtgcagc ccaccgagga ggcccgcgct      3840
     gcggcgtaca ccatcccgtc gtatgaggat cagtactaca gcccggactt cggtgcggcc      3900
     accggtgctg ccgtcccgct ggacgactac ggctacagcg actaccgcta g               3951
//

If you have problems or comments...

PBIL Back to PBIL home page