(data stored in ACNUC1104 zone)

EMBL: CP000717.PE692

CP000717.PE692       Location/Qualifiers
FT   CDS_pept        782751..783248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10692"
FT                   /old_locus_tag="TBFG_00680"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0678"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10692"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05035"
FT                   /protein_id="ABR05035.1"
FT                   /translation="MSVNDGVDQMGAEPDIMEFVEQMGGYFESRSLTRLAGRLLGWLLV
FT                   CDPERQSSEELATALAASSGGISTNARMLIQFGFIERLAVAGDRRTYFRLRPNAFAAGE
FT                   RERIRAMAELQDLADVGLRALGDAPPQRSRRLREMRDLLAYMENVVSDALGRYSQRTGE
FT                   DD"
     gtgagcgtca acgacggggt cgatcagatg ggcgccgagc ccgacatcat ggaattcgtc        60
     gaacagatgg gcggctattt cgagtccagg agtttgactc ggttggcggg tcgattgttg       120
     ggctggctgc tggtgtgtga tcccgagcgg cagtcctcgg aggaactggc gacggcgctg       180
     gcggccagca gcggggggat cagcaccaat gcccggatgc tgatccaatt tgggttcatt       240
     gagcggctcg cggtcgccgg ggatcggcgc acctatttcc ggttgcggcc caacgctttc       300
     gcggctggcg agcgtgaacg catccgggca atggccgaac tgcaggacct ggctgacgtg       360
     gggctgaggg cgctgggcga cgccccgccg cagcgaagcc gacggctgcg ggagatgcgg       420
     gatctgttgg catatatgga gaacgtcgtc tccgacgccc tggggcgata cagccagcga       480
     accggagagg acgactga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page