(data stored in ACNUC1104 zone)

EMBL: CP000717.PE693

CP000717.PE693       Location/Qualifiers
FT   CDS_pept        complement(783304..783801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10693"
FT                   /old_locus_tag="TBFG_00681"
FT                   /product="conserved threonine rich protein"
FT                   /note="Mapped to H37Rv Rv0679c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10693"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05036"
FT                   /protein_id="ABR05036.1"
FT                   /translation="MVEKPLRADRATHSRLATFALALAAAALPLAGCSSTANPPAATTT
FT                   PATATTTTATSGPTAAPTVTTGESTTASIQIGDMLTYGSIGTTATLDCADGKSLNVAGS
FT                   DNTLTVNGTCETVTVGGANNKIAFDRIDERLVVVGLDNTVTYKNGDPTIDNLGAGNRIN
FT                   KE"
     gtggtcgaga aaccgttgcg cgccgatcgc gctacccact cccggttggc gacctttgct        60
     ctggcgctgg ctgccgcagc gttgccgctg gccggctgca gttccactgc caacccgccg       120
     gcagctacca cgacgcccgc gaccgccacc accacgacag cgacgagcgg cccgaccgcg       180
     gcgccgaccg tgacgaccgg agaatccaca accgcttcga tccagatcgg tgacatgctg       240
     acctacggat ccatcgggac taccgccacc cttgactgcg ctgacggcaa gtcactgaac       300
     gtggccggct cggacaacac gctgaccgtc aacggcacct gcgaaacggt gaccgtcggt       360
     ggtgcgaaca acaagatcgc cttcgacagg atcgacgagc gcctcgttgt tgttgggctg       420
     gacaacacgg tcacctacaa aaacggtgac cccacaatcg ataacctcgg cgcgggcaac       480
     cgcatcaaca aggagtga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page