(data stored in ACNUC1104 zone)

EMBL: CP000717.PE694

CP000717.PE694       Location/Qualifiers
FT   CDS_pept        complement(783803..784177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10694"
FT                   /old_locus_tag="TBFG_00682"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0680c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10694"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05037"
FT                   /protein_id="ABR05037.1"
FT                   /translation="MKWNTVAASLAAGVITIAVALAAPPPAAHAKNGDTHVTGQGIERT
FT                   LDCNESTLLVNGTQNIVTALGTCWAVTVMGSSNTVVADTIINDITVYGWDETVFFRNGD
FT                   PFIWDRGRELGMVNRLQRVG"
     gtgaagtgga acaccgtcgc cgcgtcgctg gctgccggtg tcatcaccat cgctgtcgcc        60
     ttggccgccc caccgccggc cgcacacgcc aagaacggcg acacccatgt caccgggcag       120
     ggcatcgagc ggacgctgga ctgcaacgaa tccaccttgt tggtcaacgg cactcagaac       180
     atcgtgaccg cgctgggaac ctgctgggcg gtgaccgtga tgggctcgtc caacaccgtt       240
     gtcgccgaca cgatcatcaa cgacatcacc gtctacggct gggacgaaac ggtgttcttc       300
     cgcaatggtg atccgttcat ctgggaccgt ggccgggaac taggaatggt aaaccgactg       360
     cagcgggtcg gctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page