(data stored in ACNUC1104 zone)

EMBL: CP000717.PE706

CP000717.PE706       Location/Qualifiers
FT   CDS_pept        795592..795921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10706"
FT                   /old_locus_tag="TBFG_00695"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0692"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10706"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05049"
FT                   /protein_id="ABR05049.1"
FT                   /translation="MWGLLTVPAPAQARRADSSEFDPDRGWRLHPQVAVRPEPFGALLY
FT                   HFGTRKLSFLKNRTILAVVQTLADYPDIRSACRGAGVDDCDQDPYLHALSVLTGSNMLV
FT                   PRQTT"
     gtgtggggtt tactgaccgt gccggcgccc gcgcaggctc gccgggctga ttccagcgaa        60
     ttcgatcccg atcgcggctg gcgactacac ccacaggtgg cggtccggcc ggagcctttt       120
     ggcgcgctgc tctatcactt cggcacccgt aagttgtcat ttctgaaaaa tcgcaccatc       180
     ctcgcggtgg tgcagacgct ggcggattat cccgatatcc ggtcggcctg ccgcggcgcc       240
     ggcgtcgacg actgtgacca ggatccgtac ctgcacgccc tgagtgtgct caccggttcg       300
     aacatgctgg ttcctcggca gacaacatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page