(data stored in ACNUC1104 zone)

EMBL: CP000717.PE712

CP000717.PE712       Location/Qualifiers
FT   CDS_pept        802594..803205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10712"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0698"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10712"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05055"
FT                   /protein_id="ABR05055.1"
FT                   /translation="MGRRGNRRVHVDRVRLTGTERELRAENQSPPIFRPQNTLGDGANG
FT                   LPLAVCTTTAHTCHTSHTHPSRWTPNPVPATKGVPAGLVQATFIIENLDPGNNDTPTPP
FT                   TPKLRLARKPGHHRRSEYDADSVLRRKDTSRRCVQADDVRCVQLVQDPRRGRVELGGYR
FT                   AELTVGRRAAVNCQRPQYGADGWPVRLGCGVGGAARGDQR"
     ttgggtcgca ggggtaaccg aagggtgcac gttgaccgcg tgaggctaac cggcaccgag        60
     cgtgaactga gggcggagaa tcagagcccc ccgattttcc gcccgcagaa cacgttgggc       120
     gacggcgcca acgggctgcc actggccgtg tgcaccacga cggctcacac gtgccacact       180
     tcccatactc acccatcgcg gtggacccca aacccagtgc cggccaccaa gggcgtcccc       240
     gctggattgg tgcaagcaac cttcatcatc gaaaaccttg accccggcaa caacgacacg       300
     ccgacccccc ctacacccaa actgcgatta gcccgaaaac ctgggcacca taggcgatct       360
     gaatacgatg cggattcggt gctgcggaga aaggatacat cgcgccgatg cgtccaggcg       420
     gatgacgtcc gatgcgtgca gctggtccag gatccgcggc gcggacgtgt cgaactcggt       480
     ggttaccgcg ccgagcttac tgttggccga cgggcggcgg tgaattgcca acgcccgcaa       540
     tatggtgcgg atggatggcc cgttcggttg ggttgcgggg taggcggcgc cgcgcgaggc       600
     gatcagcgct ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page