(data stored in ACNUC1104 zone)

EMBL: CP000717.PE713

CP000717.PE713       Location/Qualifiers
FT   CDS_pept        complement(802921..803568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10713"
FT                   /old_locus_tag="TBFG_00701"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0698"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10713"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05056"
FT                   /protein_id="ABR05056.1"
FT                   /translation="MALAKLAQSADRIAARQRMQRSLAQLVATCELPAPTGTAPIERRI
FT                   SESFAASRSTRRSPIAQSMTRPSPPRPGSPTLPVDGEDPFAEAVLTASVSCRLYPTDTG
FT                   GTPADRCTPATGGEFPTSALIASRGAAYPATQPNGPSIRTILRALAIHRRPSANSKLGA
FT                   VTTEFDTSAPRILDQLHASDVIRLDASARCILSPQHRIRIVFRSPMVPRFSG"
     ttggccctag ccaagttggc acagtcggcc gacagaatcg ccgcccgaca gcggatgcaa        60
     cgatcactcg cccaactcgt cgccacctgc gagcttcccg cgccgaccgg tactgccccc       120
     atcgagcgcc ggatctccga gtccttcgcc gcgagcagat cgacacgacg atcacccatc       180
     gcacaatcaa tgaccagacc gtcgccgccg aggccgggat caccaaccct gcctgtcgac       240
     ggcgaagacc cgtttgccga agccgttttg acggcgagcg tgtcctgccg cctctacccg       300
     acagacaccg gcggcacccc agccgaccgc tgtactcccg cgaccggagg tgaattcccg       360
     acctcagcgc tgatcgcctc gcgcggcgcc gcctaccccg caacccaacc gaacgggcca       420
     tccatccgca ccatattgcg ggcgttggca attcaccgcc gcccgtcggc caacagtaag       480
     ctcggcgcgg taaccaccga gttcgacacg tccgcgccgc ggatcctgga ccagctgcac       540
     gcatcggacg tcatccgcct ggacgcatcg gcgcgatgta tcctttctcc gcagcaccga       600
     atccgcatcg tattcagatc gcctatggtg cccaggtttt cgggctaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page