(data stored in ACNUC1104 zone)

EMBL: CP000717.PE715

CP000717.PE715       Location/Qualifiers
FT   CDS_pept        804570..805223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10715"
FT                   /old_locus_tag="TBFG_00703"
FT                   /product="50S ribosomal protein L3 rplC"
FT                   /note="Mapped to H37Rv Rv0701"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10715"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05058"
FT                   /protein_id="ABR05058.1"
FT                   /translation="MARKGILGTKLGMTQVFDESNRVVPVTVVKAGPNVVTRIRTPERD
FT                   GYSAVQLAYGEISPRKVNKPLTGQYTAAGVNPRRYLAELRLDDSDAATEYQVGQELTAE
FT                   IFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKG
FT                   TRMAGRMGNDRVTVLNLLVHKVDAENGVLLIKGAVPGRTGGLVMVRSAIKRGEK"
     atggcacgaa agggcattct cggtaccaag ctgggtatga cgcaggtatt cgacgaaagc        60
     aacagagtag taccggtgac cgtggtcaag gccgggccca acgtggtaac ccgcatccgc       120
     acgcccgaac gcgacggtta tagcgccgtg cagctggcct atggcgagat cagcccacgc       180
     aaggtcaaca agccgctgac aggtcagtac accgccgccg gcgtcaaccc acgccgatac       240
     ctggcggagc tgcggctgga cgactcggat gccgcgaccg agtaccaggt tgggcaagag       300
     ttgaccgcgg agatcttcgc cgatggcagc tacgtcgatg tgacgggtac ctccaagggc       360
     aaaggtttcg ccggcaccat gaagcggcac ggcttccgcg gtcagggcgc cagtcacggt       420
     gcccaggcgg tgcaccgccg tccgggctcc atcggcggat gtgccacgcc ggcgcgggtg       480
     ttcaagggca cccggatggc cgggcggatg ggcaatgacc gggtgaccgt tcttaacctt       540
     ttggtgcata aggtcgatgc cgagaacggc gtgctgctga tcaagggtgc ggttcctggc       600
     cgcaccggtg gactggtcat ggtccgcagt gcgatcaaac gaggtgagaa gtga             654
//

If you have problems or comments...

PBIL Back to PBIL home page