(data stored in ACNUC1104 zone)

EMBL: CP000717.PE717

CP000717.PE717       Location/Qualifiers
FT   CDS_pept        805894..806196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10717"
FT                   /old_locus_tag="TBFG_00705"
FT                   /product="50S ribosomal protein L23 rplW"
FT                   /note="Mapped to H37Rv Rv0703"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10717"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05060"
FT                   /protein_id="ABR05060.1"
FT                   /translation="MATLADPRDIILAPVISEKSYGLLDDNVYTFLVRPDSNKTQIKIA
FT                   VEKIFAVKVASVNTANRQGKRKRTRTGYGKRKSTKRAIVTLAPGSRPIDLFGAPA"
     atggcgacgc tcgctgaccc ccgcgacatc atcctggccc cggtgatctc ggagaaatcc        60
     tatgggttgc tggatgacaa cgtgtacacg tttttggtgc gcccggattc caacaagacg       120
     cagatcaaga tcgccgtcga gaagattttt gccgtcaagg tcgcatcggt gaacaccgcg       180
     aaccggcagg gcaagcgtaa acgcacccgg accggatacg gcaagcgcaa gagcaccaag       240
     cgcgccatcg tcaccctggc gccgggcagc aggccgatcg acctgttcgg ggcaccggcc       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page