(data stored in ACNUC1104 zone)

EMBL: CP000717.PE723

CP000717.PE723       Location/Qualifiers
FT   CDS_pept        809395..809628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10723"
FT                   /old_locus_tag="TBFG_00711"
FT                   /product="50S ribosomal protein L29 rpmC"
FT                   /note="Mapped to H37Rv Rv0709"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10723"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05066"
FT                   /protein_id="ABR05066.1"
FT                   /translation="MAVGVSPGELRELTDEELAERLRESKEELFNLRFQMATGQLNNNR
FT                   RLRTVRQEIARIYTVLRERELGLATGPDGKES"
     atggcagtgg gtgtctcgcc gggcgaactg cgtgagctca ccgacgagga gctggccgag        60
     cggttgcgcg agtccaagga agagttgttc aacttgcgtt tccagatggc gaccggccag       120
     ctcaacaata accgccggct ccgtacggtg cgtcaggaaa tcgcgcgcat ctacaccgtg       180
     ctgcgcgaac gagaactggg tctggcgact gggcccgatg gtaaggaatc gtga             234
//

If you have problems or comments...

PBIL Back to PBIL home page