(data stored in ACNUC1104 zone)

EMBL: CP000717.PE728

CP000717.PE728       Location/Qualifiers
FT   CDS_pept        815242..815610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10728"
FT                   /old_locus_tag="TBFG_00716"
FT                   /product="50S ribosomal protein L14 rplN"
FT                   /note="Mapped to H37Rv Rv0714"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10728"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05071"
FT                   /protein_id="ABR05071.1"
FT                   /translation="MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKD
FT                   AIPGGNVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFGPVGR
FT                   ELREKRFMKIISLAPEVL"
     gtgattcagc aggaatcgcg gctgaaggtc gccgacaaca ccggcgccaa ggagatcttg        60
     tgcatccggg tgctgggcgg ttcgtcgcga cgctacgccg gcatcggtga cgtcatcgtc       120
     gccaccgtga aggacgccat tccgggcggc aacgttaagc ggggggatgt cgtcaaggcc       180
     gtcgtggtgc gcacagtcaa ggaacgccga cgtcccgacg gcagctacat caagttcgac       240
     gagaacgccg cggtgatcat caagcccgac aacgacccgc gcggcacccg catttttgga       300
     ccggtcggtc gcgagctgcg ggagaagcgg tttatgaaga tcatttcgct ggccccggag       360
     gtgttgtag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page