(data stored in ACNUC1104 zone)

EMBL: CP000717.PE733

CP000717.PE733       Location/Qualifiers
FT   CDS_pept        817267..817806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10733"
FT                   /old_locus_tag="TBFG_00721"
FT                   /product="50S ribosomal protein L6 rplF"
FT                   /note="Mapped to H37Rv Rv0719"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10733"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05076"
FT                   /protein_id="ABR05076.1"
FT                   /translation="MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVAR
FT                   NDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNL
FT                   EFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGV
FT                   RYEGEQIRRKVGKTGK"
     atgtcgcgta ttggtaagca gccgattccg gtgcccgccg gggtcgacgt cacgatcgag        60
     ggacagagca tctcggttaa ggggcccaag ggcaccctag gactgacggt cgccgagcca       120
     atcaaagtgg cacgcaatga cgacggcgct atcgtggtca cccgtcccga cgatgagcgg       180
     cgtaatcgct ccttacacgg gctgtcccgt accctggtgt ccaacctggt cactggcgtg       240
     acgcaggggt acaccaccaa gatggagatc ttcggggttg gctatcgggt gcagctcaag       300
     ggctccaatc tggagtttgc gctggggtac agccacccgg tggtgatcga ggctcccgaa       360
     ggaatcacgt tcgccgtcca ggcaccgacg aagttcaccg tttccgggat cgacaaacaa       420
     aaagtcggcc agatcgccgc caatatccgc cgtcttcgcc gtcccgatcc gtacaagggc       480
     aagggcgtgc gctacgaggg cgagcagatc cgccgcaagg tcggaaagac aggtaagtag       540
//

If you have problems or comments...

PBIL Back to PBIL home page