(data stored in ACNUC1104 zone)

EMBL: CP000717.PE737

CP000717.PE737       Location/Qualifiers
FT   CDS_pept        819059..819499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10737"
FT                   /old_locus_tag="TBFG_00725"
FT                   /product="50S ribosomal protein L15 rplO"
FT                   /note="Mapped to H37Rv Rv0723"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10737"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05080"
FT                   /protein_id="ABR05080.1"
FT                   /translation="MTLKLHDLRPARGSKIARTRVGRGDGSKGKTAGRGTKGTRARKQV
FT                   PVTFEGGQMPIHMRLPKLKGFRNRFRTEYEIVNVGDINRLFPQGGAVGVDDLVAKGAVR
FT                   KNALVKVLGDGKLTAKVDVSAHKFSGSARAKITAAGGSATEL"
     gtgacgctca agctgcatga cctgcgcccc gcgcgggggt ccaagatcgc ccgcacccga        60
     gtcggtcgag gtgacggctc caagggcaag acggccggcc gtggcaccaa gggcaccagg       120
     gcccgcaagc aggtgccggt gaccttcgag ggcgggcaga tgccgatcca catgcggctg       180
     cccaagctca agggcttccg taaccggttt cgcaccgaat acgaaattgt caacgtcggc       240
     gacatcaacc ggctgtttcc gcagggtggt gccgtcggcg tggacgacct ggtggccaag       300
     ggggccgtcc gcaagaacgc tctggtcaag gtgttgggtg acggcaagct gaccgccaag       360
     gtcgacgtgt ccgcgcacaa gttcagcggc agcgcgcgcg cgaagatcac cgcagcgggc       420
     ggttcagcca ccgagctcta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page