(data stored in ACNUC1104 zone)

EMBL: CP000717.PE739

CP000717.PE739       Location/Qualifiers
FT   CDS_pept        complement(821408..822313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10739"
FT                   /old_locus_tag="TBFG_00727"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0725c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10739"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05082"
FT                   /protein_id="ABR05082.1"
FT                   /translation="MPRAHDDNWDLASSVGATATMVAAGRALATKDPRGLINDPFAEPL
FT                   VRAVGLDFFTKLIDGELDIATTGNLSPGRAQAMIDGIAVRTKYFDDYFRTATDGGVRQV
FT                   VILAAGLDARAYRLPWPAGTVVYEIDQPQVIDFKTTTLAGIGAKPTAIRRTVYIDLRAD
FT                   WPAALQAAGLDSTAPTAWLAEGMLIYLPPDPRTGCSTTAPNSVLRAARSLPNLSRALWI
FT                   STQAGYEKWRIRFASTAWTSTWRRWCIPANAATSSTTCAPRAGTLRAQCGPTYSGAMVC
FT                   PFPPHTTTIRSAKSSSSAVV"
     atgccgcgcg ctcacgacga caactgggat ctagcctcca gcgtcggggc taccgcgacc        60
     atggttgctg ccggacgcgc gttggcgacc aaggatccac gaggtttgat caacgacccg       120
     ttcgccgaac cgctggtgcg cgcggtcggg ctggatttct tcaccaagtt gatcgacggc       180
     gagctcgata tcgcgacgac cgggaacctt tcgccggggc gggcacaggc gatgatcgac       240
     gggatagcgg tgcgcaccaa gtacttcgac gactacttcc gcactgccac ggacggcgga       300
     gtgcgacaag tggtgatcct ggcagccggg ttggacgcgc gcgcctatcg gttgccgtgg       360
     ccggccggca ccgtggtcta cgagatcgac caaccacagg tgatcgactt caagacaacc       420
     accttggccg gcatcggcgc caagcccacc gccattcggc gcacggtgta catcgacttg       480
     cgcgcggact ggccggcggc actgcaagct gccggcctgg actcgacggc accgacagca       540
     tggttggccg aaggcatgct gatctacctg ccgccggatc ccaggaccgg ttgttcgaca       600
     acagcaccga actcagtgtt gcgggcagca cgatcgctac cgaacttgtc ccgggcattg       660
     tggatttcga cgcaggccgg gtacgagaaa tggcggattc gtttcgcaag cacggcgtgg       720
     acatcgacat ggcgtcgctg gtgtattccg gcgaacgcag ccacgtcgtc gactacctgc       780
     gcgccaaggg ctgggacgtt gagggcacag tgcggaccga cctattcagg cgcaatggtt       840
     tgcccgttcc cgccccacac gacgacgatc cgctcggcga aatcatcttc atcagcggtc       900
     gtttga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page