(data stored in ACNUC1104 zone)

EMBL: CP000717.PE740

CP000717.PE740       Location/Qualifiers
FT   CDS_pept        complement(822406..823509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10740"
FT                   /old_locus_tag="TBFG_00728"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0726c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10740"
FT                   /db_xref="EnsemblGenomes-Tr:ABR05083"
FT                   /protein_id="ABR05083.1"
FT                   /translation="MTYTGSIRCEGDTWDLASSVGATATMVAAARAMATRAANPLINDQ
FT                   FAEPLVRAVGVDVLTRLASGELTASDIDDPERPNASMVRMAEHHAVRTKFFDEFFMDAT
FT                   RAGIRQVVILASGLDSRAYRLAWPAQTVVYEIDQPQVMEFKTRTLAELGATPTADRRVV
FT                   TADLRADWPTALGAAGFDPTQPTAWSAEGLLRYLPPEAQDRLLDNVTALSVPDSRFATE
FT                   SIRNFKPHHEERMRERMTILANRWRAYGFDLDMNELVYFGDRNEPASYLSDNGWLLTEI
FT                   KSQDLLTANGFQPFEDEEVPLPDFFYVSARLQRKHRQYPAHRKPAPSWRHTACPVNELS
FT                   KSAAYTMTRSDAHQASTTAPPPPGLTG"
     atgacataca ccggttccat caggtgcgaa ggggacacct gggatctggc atccagcgtc        60
     ggggcgaccg ccacgatggt tgcggcggct cgcgcgatgg cgacccgcgc cgccaaccca       120
     ctgatcaacg atcagttcgc tgagccgctg gtccgggcgg tgggggtgga cgttctgacc       180
     cggctcgcga gcggggaatt gacggcctca gacatcgacg atccggaacg cccgaatgcg       240
     tccatggtcc gtatggccga acaccatgcc gtccgcacca agttcttcga cgagttcttc       300
     atggatgcga cacgcgcggg catcaggcag gtcgtgatcc tggcctcagg attggattcc       360
     cgggcatacc ggctggcctg gcccgcccag accgtggtgt atgagatcga ccaaccgcaa       420
     gtcatggagt tcaaaactcg cacactcgcc gaactgggcg ccacgcccac cgccgaccgg       480
     cgcgtggtca ccgccgattt gcgtgcggat tggcccaccg cgttgggcgc ggcgggattc       540
     gacccgaccc agcccaccgc gtggagcgct gaagggttgc tccgctacct cccgccggaa       600
     gcgcaggacc gcttgttgga caatgtcacc gcgctcagtg tgccggacag caggtttgca       660
     accgagagca tacgcaactt caagccgcat catgaggaac ggatgaggga gcgcatgacg       720
     atcctcgcca atcgttggcg cgcatacggt ttcgatctag acatgaatga gctggtgtac       780
     ttcggcgacc gcaacgagcc cgcctcgtac ctatccgaca atggttggct gctgaccgag       840
     atcaaatccc aggacctgct gaccgccaac ggatttcaac cgttcgagga cgaagaagtg       900
     ccgttgcctg atttcttcta tgtcagcgcc aggttgcaac ggaaacacag acagtaccca       960
     gcacaccgca agccagcacc ttcgtggcgc cataccgctt gccccgtcaa tgaactgtcg      1020
     aaatcggccg cctacacgat gactcgcagt gatgctcacc aggcttcgac gactgctcca      1080
     ccgccgccag ggcttaccgg ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page