(data stored in ACNUC1104 zone)

EMBL: CP000717.PE78

CP000717.PE78        Location/Qualifiers
FT   CDS_pept        86661..87266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10078"
FT                   /old_locus_tag="TBFG_00078"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0078"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10078"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04421"
FT                   /protein_id="ABR04421.1"
FT                   /translation="MEIKRRTQEERSAATREALITGARKLWGLRGYAEVGTPEIATEAG
FT                   VTRGAMYHQFADKAALFRDVVEVVEQDVMARMATLVAASGAATPADAIRAAVDAWLEVS
FT                   GDPEVRQLILLDAPVVLGWAGFRDVAQRYSLGMTEQLITEAIRAGQLARQPVRPLAQVL
FT                   IGALDEAAMFIATADDPKRARRETRQVLRRLIDGMLNG"
     atggaaatca agagacgcac ccaggaggaa cgctccgcgg cgacccgcga ggcgctgatc        60
     accggggccc gcaagctgtg ggggttacgg ggttatgcgg aggtggggac gccggaaatc       120
     gcgaccgagg cgggggtcac gcggggggcg atgtaccacc aattcgccga taaagcagca       180
     ctattccgcg atgtggtgga ggtcgtggag caagacgtga tggcccggat ggccaccttg       240
     gtcgccgcct cgggggcggc gacgccggcc gatgcaatcc gggcagcggt cgatgcctgg       300
     ctcgaggtat ctggtgatcc ggaggtgcgt cagctgatcc tgctggatgc gcccgtcgtg       360
     ctgggctggg cgggtttccg cgacgtcgcc cagcgataca gcctgggcat gaccgaacag       420
     ttgatcaccg aggcgatccg ggccggccag ttggctcgtc aaccggtgcg gccgctggcc       480
     caggtgctca ttggcgcgct cgacgaggcg gcgatgttca tcgccaccgc cgacgacccc       540
     aagcgcgccc gtcgggagac cagacaggtg ctgcgccggc tcatcgacgg gatgcttaac       600
     ggctag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page