(data stored in ACNUC1104 zone)

EMBL: CP000717.PE80

CP000717.PE80        Location/Qualifiers
FT   CDS_pept        88337..89158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10080"
FT                   /old_locus_tag="TBFG_00080"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0079"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10080"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04423"
FT                   /protein_id="ABR04423.1"
FT                   /translation="MEPKRSRLVVCAPEPSHAREFPDVAVFSGGRANASQAERLARAVG
FT                   RVLADRGVTGGARVRLTMANCADGPTLVQINLQVGDTPLRAQAATAGIDDLRPALIRLD
FT                   RQIVRASAQWCPRPWPDRPRRRLTTPAEALVTRRKPVVLRRATPLQAIAAMDAMDYDVH
FT                   LFTDAETGEDAVVYRAGPSGLRLARQHHVFPPGWSRCRAPAGPPVPLIVNSRPTPVLTE
FT                   AAAVDRAREHGLPFLFFTDQATGRGQLLYSRYDGNLGLITPTGDGVADGLA"
     gtggaaccga aacgcagtcg cctcgtcgta tgtgcacccg agccatcgca cgcgcgggaa        60
     ttcccggatg tcgccgtatt ctccggcggc cgggctaacg catcccaggc cgaacggttg       120
     gctcgtgccg tgggtcgcgt gttggccgat cggggcgtca ccgggggtgc tcgggtgcgg       180
     ctgaccatgg cgaactgcgc cgatgggccg acgctggtgc agataaacct gcaggtaggt       240
     gacaccccat taagggcgca ggccgccacc gcgggcatcg atgatctgcg acccgcactg       300
     atcagactgg atcgacagat cgtgcgggcg tcggcacagt ggtgcccccg gccttggccg       360
     gatcggcccc gccggcgatt gaccacgccg gccgaggcgc tagtcacccg ccgcaaaccg       420
     gtcgtgctaa ggcgcgcaac cccgttgcag gcgattgccg ctatggacgc catggactac       480
     gacgtgcatt tgttcaccga cgccgagacg ggggaggacg ctgtggtcta tcgggctgga       540
     ccgtcggggc tgcggctggc ccgccagcac cacgtatttc ccccaggatg gtcacgttgt       600
     cgcgccccag ccgggccgcc ggtgccgctg attgtgaatt cgcgtccgac accggttctc       660
     acggaggccg ccgcggtgga ccgggcgcgc gaacatggac tgccattcct gtttttcacc       720
     gaccaggcca ccggccgcgg ccagctgctc tactcccgct acgacggcaa cctcgggttg       780
     atcaccccga ccggtgacgg cgttgccgac ggtctggcat ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page