(data stored in ACNUC1104 zone)

EMBL: CP000717.PE81

CP000717.PE81        Location/Qualifiers
FT   CDS_pept        89155..89613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10081"
FT                   /old_locus_tag="TBFG_00081"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0080"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10081"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04424"
FT                   /protein_id="ABR04424.1"
FT                   /translation="MSPGSRRASPQSAREVVELDRDEAMRLLASVDHGRVVFTRAALPA
FT                   IRPVNHLVVDGRVIGRTRLTAKVSVAVRSSADAGVVVAYEADDLDPRRRTGWSVVVTGL
FT                   ATEVSDPEQVARYQRLLHPWVNMAMDTVVAIEPEIVTGIRIVADSRTP"
     atgagcccgg gctcgcggcg cgccagcccg caaagcgccc gggaggtggt cgagctcgac        60
     cgtgacgagg cgatgcggtt gctggccagc gttgaccatg ggcgtgtggt gttcacccgc       120
     gcggcgctgc cggcgatccg tccagtcaat cacctcgtgg tcgacggtcg ggtgatcggg       180
     cgcacccgcc tgacggccaa ggtgtccgtt gcggtgcgat cgagcgccga tgccggtgtc       240
     gtggtcgcct acgaagccga cgaccttgat ccgcggcgtc ggacggggtg gagtgtggtg       300
     gtgacgggac tggcgaccga ggtcagcgat cccgagcagg ttgcccgcta ccagcggctg       360
     ctacacccgt gggtgaacat ggcgatggac accgtggtcg cgatcgaacc cgagatcgtc       420
     accggcatcc gcatcgttgc tgactcgcgt acgccgtag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page