(data stored in ACNUC1104 zone)

EMBL: CP000717.PE82

CP000717.PE82        Location/Qualifiers
FT   CDS_pept        89708..90052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10082"
FT                   /old_locus_tag="TBFG_00082"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0081"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10082"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04425"
FT                   /protein_id="ABR04425.1"
FT                   /translation="MESEPLYKLKAEFFKTLAHPARIRILELLVERDRSVGELLSSDVG
FT                   LESSNLSQQLGVLRRAGVVAARRDGNAMIYSIAAPDIAELLAVARKVLARVLSDRVAVL
FT                   EDLRAGGSAT"
     gtggagtccg aaccgctgta caagctcaag gcggagttct tcaaaaccct tgcgcatccg        60
     gcgcggatca ggattttgga gctgctggtc gagcgggacc gttcggtcgg tgagttgctg       120
     tcctcggacg tcggcctgga gtcgtcgaac ctgtcccagc agctgggtgt gctacgccgg       180
     gcgggtgttg tcgcggcacg tcgtgacggc aacgcgatga tctattcgat tgccgcaccc       240
     gatatcgccg agctgctggc ggtggcacgc aaggtgctgg ccagggtgct cagcgaccgg       300
     gtggcggtgc tagaggacct ccgcgccggc ggctcggcca cgtaa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page