(data stored in ACNUC1104 zone)

EMBL: CP000717.PE96

CP000717.PE96        Location/Qualifiers
FT   CDS_pept        complement(104567..105349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10096"
FT                   /old_locus_tag="TBFG_00095"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0095c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10096"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04439"
FT                   /protein_id="ABR04439.1"
FT                   /translation="MRYLPVSTRRIWVNPLCHFSFTVISGALFVSARRYDSNMLANSRE
FT                   ELVEVFDALDADLDRLDEVSFEVLSTPERLRSLERLECLARRLPAAQHTLINQLDTQAS
FT                   EEELGGTLCCALANRLRITKPEAGRRIADAADLGPRRALTGEPLAPQLTATATAQRQGL
FT                   IGEAHIKVIRALFRPPARRGGCVHPPGRRSRPGRQSRSISSRRAGPLRPAGHGLATPRR
FT                   RPHRHRTRPQTRHHPEQPAIRRHVTAKWLPDPPSAGHL"
     gtgcggtacc ttcccgtatc aactcgtagg atctgggtaa atcccttgtg tcacttcagt        60
     ttcacggtta tcagcggggc gctctttgtc agtgcccgac gttatgattc gaacatgtta       120
     gcgaatagcc gggaggagct tgtcgaggtc ttcgacgcgc tggatgccga cctggaccgc       180
     ttggacgagg tgtcctttga ggtgctgagc accccggaac ggctgcggtc tctggaacgt       240
     ctggaatgct tggcgcgccg gctaccggcg gcccagcaca cgttgatcaa ccaactcgac       300
     acccaagcca gcgaggaaga actgggcggc acgctgtgct gcgcgctggc caaccggctg       360
     cgcatcacca agcccgaagc cggccgacgc atcgccgacg ccgccgatct cggacctcgt       420
     cgagcactca ccggtgaacc gctagcccca cagttgaccg ccaccgccac cgcccaacgc       480
     cagggcctga tcggcgaggc gcacatcaaa gtgattcgcg ccctttttcg cccacctgcc       540
     cgccgcggtg gatgtgtcca cccgccaggc cgccgaagcc gacctggccg gcaaagccgc       600
     tcaatatcgt cccgacgagc tggcccgcta cgcccagcgg gtcatggact ggctacaccc       660
     cgacggcgac ctcaccgaca ccgaacgcgc ccgcaaacgc ggcatcaccc tgagcaacca       720
     gcaatacgac ggcatgtcac ggctaagtgg ctacctgacc ccccaagcgc gggccacctt       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page