(data stored in ACNUC1104 zone)

EMBL: CP000717.PE99

CP000717.PE99        Location/Qualifiers
FT   CDS_pept        107734..108285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10099"
FT                   /old_locus_tag="TBFG_00098"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0098"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10099"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04442"
FT                   /protein_id="ABR04442.1"
FT                   /translation="MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQ
FT                   YSATEDSVLAYGNFTIGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIRVLRG
FT                   WSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEF
FT                   WDENGGAASGEIELAALNIP"
     atgagccaca ccgacttgac gccctgcaca cgggtgctgg catccagcgg cacggttccg        60
     atcgcagagg aactgctggc cagagtgctc gagccctact cctgcaaagg atgtcgctac       120
     ctcatcgacg cacagtacag cgccaccgag gattcggttc ttgcctatgg caacttcacg       180
     atcggtgagt ccgcctatat tcgaagcacg gggcacttca acgcggtcga actgattctg       240
     tgtttcaatc agctcgccta cagcgccttc gctccggccg tcctcaacga ggaaatccgg       300
     gtgcttcgcg gctggtcgat cgacgactac tgccaacacc agctctctag catgctgatc       360
     aggaaggcat catcgcggtt cagaaaaccg ctgaacccgc aaaagttctc tgcccgcctc       420
     ctgtgtcgag atctgcaggt catcgaacga acctggcgct atctcaaggt cccgtgcgtc       480
     atcgagttct gggacgagaa cggcggggcg gcgtccggtg agatcgaact agcggccctc       540
     aacattccgt aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page