(data stored in ACNUC7421 zone)

EMBL: CP000769.PE1

CP000769.PE1         Location/Qualifiers
FT   CDS_pept        48..1430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; SMART: AAA ATPase;
FT                   KEGG: ade:Adeh_0001 chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24221"
FT                   /db_xref="GOA:A7H675"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A7H675"
FT                   /protein_id="ABS24221.1"
FT                   /translation="MDSRASAKWIGPSDETALWARIDTYLRSRLRPDLYDRWFAPLRLV
FT                   SLEGGRLQIAAPDPFHRDFVEDNYRAFFEEFAPGILGRQLPIAFVVDSAPRVASPPAPA
FT                   AGPALSPVPRAAEPADPRESRPNPRYTFDTFVVGESNRFAFAAAQAVAANPGHTWNPLF
FT                   LHGDSGLGKTHLLHALAHAILDKQGGRVAIVSSERYTNDFVAALSKGTMDDFRRKYREC
FT                   TALLVDDVQFLAGKDKTAEEFFHTFNELHDHHVQIVLSSDRSPKELKGLDARLCSRFEW
FT                   GMRVQVEAPEFETRAAILQKKAEVESIDLPGDVTQLLAAHIRSNVRELEGALMRLAAFA
FT                   SLKSEPITVALARDVLSDVIPPEGYKPTIERIQEAVAAHYGLTVAKLTSSSREQKIALP
FT                   RQAAMYLCRELGKEKFQAIAERFNKKDHTTVIAAVERIRTLMETEEPVRSAVQVLTSKL
FT                   AP"
     atggattcgc gcgcgagcgc caagtggatc gggccgtccg acgaaacggc gctctgggct        60
     cgaatcgaca cgtacctccg ctcccggctg cgccccgatc tctacgatcg gtggttcgcc       120
     ccgctccgcc tcgtctcgct ggagggcggg cggttgcaga tcgcggcgcc ggatccgttc       180
     caccgcgact tcgtggagga caactaccgc gccttcttcg aggagttcgc gcccggcatc       240
     ctgggcaggc agctgcccat cgccttcgtg gtggactcgg ccccgcgcgt cgcctccccg       300
     cccgcccccg ccgccgggcc ggccctctcg cctgtgccgc gcgcggccga gcccgcggac       360
     ccgcgcgagt cgcgcccgaa cccgcgctac accttcgaca ccttcgtggt gggcgagtcg       420
     aaccgcttcg ccttcgccgc ggcccaggcc gtcgccgcga accccggcca cacctggaac       480
     ccgctcttcc tccacggcga ctcgggcctc ggcaagacgc acctgctcca cgcgctcgcc       540
     cacgccatcc tggacaagca gggcggccgc gtcgcgatcg tctcctcgga gcgttacacg       600
     aacgacttcg tggcggcgct ctcgaagggc acgatggacg acttccgccg caagtaccgg       660
     gagtgcacgg ccctgctcgt cgacgacgtg cagttcctcg ccggcaagga caagaccgcg       720
     gaggagttct tccacacgtt caacgagctc cacgaccacc acgtgcagat cgtcctctcc       780
     agcgatcgca gccccaagga gctgaagggg ctcgacgccc gcctctgctc gcgcttcgag       840
     tggggcatgc gcgtccaggt ggaggcgccc gagttcgaga cccgcgccgc catcctccag       900
     aagaaggcgg aggtggagtc catcgacctg cccggcgacg tcacgcagct gctcgccgcc       960
     cacatccgct cgaacgtgcg cgagctcgag ggcgccctca tgcgcctcgc cgccttcgcc      1020
     tcgctgaaga gcgagcccat caccgtggcg ctcgcgcgcg acgtgctctc cgacgtcatc      1080
     ccgcccgagg gctacaagcc caccatcgag cgcatccagg aggccgtggc cgcccactac      1140
     ggcctcaccg tcgcgaagct cacgagcagc tcgcgcgagc agaagatcgc gctgccgcgc      1200
     caggccgcca tgtacctctg ccgcgagctc ggcaaggaga agttccaggc catcgccgag      1260
     cgcttcaaca agaaggacca caccaccgtg atcgccgccg tcgagcgcat ccgcacgctc      1320
     atggagacgg aggagccggt ccgctccgcg gtgcaggtcc tcacctccaa gctcgcgccc      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page