(data stored in ACNUC7421 zone)

EMBL: CP000769.PE10

CP000769.PE10        Location/Qualifiers
FT   CDS_pept        complement(12461..13609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24230"
FT                   /db_xref="UniProtKB/TrEMBL:A7H684"
FT                   /protein_id="ABS24230.1"
FT                   /translation="MKRLLLLVAAAALASGCVVHSGASRPIYTPPPPPAPAPPPVVSYW
FT                   YHGQHFVPDDLGGGWCYGEGPHQHDYAPHRADWYDLHEGYYYFNGPYVFAYHGGHPVPG
FT                   RGWCYVRGPHTHEYFPPQGTDFAWNRGRGWIYRGGWRPNRPPPPSYWPVVRAPRPSPRP
FT                   AHYDDPRPAPAPARPVYDPRPAPAPYPRPAPTPPRPSPGYERPVPAPAPYPVPSRPGPG
FT                   HSDDAPGHGNLPPGHGGTPPGHASPAPQPPRPPAPVPTTPGRGGEAPGHGGTPPGHAAP
FT                   PPAHGRPDRAVPPSSTPSPGNSGDARGHGGTPPGRAAPPPAQGGRDGAEPRGNGNGKGN
FT                   REGNGRGNGRGRGQREDDDDRREGEQEQGERDGRPARGDGRR"
     atgaagcgcc tgctgctact cgtcgccgcc gccgccctcg cctcgggctg cgtcgtgcac        60
     tccggcgcga gccggccgat ctacacgcct cccccgccgc cggcgcccgc gccgccgccg       120
     gtcgtgagct actggtacca cggccagcac ttcgtccccg acgacctcgg cggcggctgg       180
     tgctacgggg aggggccgca ccagcacgac tacgccccgc accgagccga ctggtacgac       240
     cttcacgaag ggtactacta cttcaacggg ccctacgtgt tcgcctacca cggcggccat       300
     cccgtgccgg ggcgcggctg gtgctacgtg cgcggaccgc acacgcacga gtacttcccg       360
     ccccagggta cggacttcgc ctggaaccgg gggcgcggct ggatctaccg cggcggctgg       420
     cggccgaacc gcccgcctcc tcccagctac tggcccgtcg tgcgcgctcc tcggcccagc       480
     ccgcggccgg cgcactacga cgatccgcgg ccggcccccg ctcccgcgcg cccggtctac       540
     gatccgcgcc cggcgcccgc tccttacccg cgcccggccc cgaccccgcc gcggccgagc       600
     cccggctacg agcggcccgt gcctgcgccc gccccgtacc ccgtgccgtc ccgccccggc       660
     cccggccaca gcgacgacgc ccccgggcac ggcaacctcc cgcccggcca cggcggcacg       720
     cccccgggac acgcttcacc agcgccgcag ccgccgcgtc cgcccgcccc cgtgccgacc       780
     acgccgggcc gcggcggcga ggctccgggg catggcggca cgccgcccgg gcacgcggct       840
     cctcctcccg cccacggccg gcccgaccga gccgtcccgc cttcctccac gccttcgccg       900
     ggcaacagcg gcgacgctcg cggccacggc ggcacgccgc ccggacgcgc cgcgccccct       960
     cccgcgcagg gcggccgaga tggcgccgag ccccgcggca acggaaacgg caaggggaac      1020
     cgcgaaggta acggccgcgg caacggccgc gggcgtggcc agcgcgagga cgacgacgat      1080
     cgtcgcgagg gcgagcagga gcagggcgag cgggacggtc gcccggcgcg cggcgacggt      1140
     cgccgctga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page