(data stored in ACNUC7421 zone)

EMBL: CP000769.PE102

CP000769.PE102       Location/Qualifiers
FT   CDS_pept        complement(125494..125883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0102"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   ade:Adeh_0101 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24322"
FT                   /db_xref="GOA:A7H6H6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H6"
FT                   /protein_id="ABS24322.1"
FT                   /translation="MALTPPAPIRILLAEDDAALAKLYASYATGRGHAVSHARDGVETL
FT                   AAALSQLPDVIVLDVAMPALDGRDVLLRLKADPRTAGIPVLVVSALGGDQHMRDLLVEL
FT                   GASDVMEKPVDLQIAFNKAERLVNG"
     atggcgctca cccccccggc cccgatcagg atcctcctcg ccgaggacga cgccgcgctc        60
     gcgaagctct acgcgagcta cgcgacgggg cggggccacg ccgtctccca cgcgcgcgac       120
     ggcgtcgaga cgctcgccgc ggcgctgtcc cagctcccgg acgtgatcgt gctcgacgtc       180
     gccatgccgg cgctcgatgg gcgcgacgtc ctgctgcggc tgaaggcgga cccgcgcacc       240
     gccggcatcc cggtgctggt cgtgtcggcg ctcggcggcg accagcacat gcgcgacctg       300
     ctcgtcgagc tgggcgcctc cgacgtgatg gagaagccgg tggacctgca gatcgccttc       360
     aacaaggcgg agcggctggt gaacgggtag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page