(data stored in ACNUC7421 zone)

EMBL: CP000769.PE103

CP000769.PE103       Location/Qualifiers
FT   CDS_pept        complement(125964..128570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24323"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H7"
FT                   /protein_id="ABS24323.1"
FT                   /translation="MIRRSLALLAAALAPPALAAAPGDPLTAARRQGEIVLDGRLEEPG
FT                   WALAPAYDGFVQIFPSEGAAPSERTEVRVLFDDRALYVGIAARDRSPGEVRRPLGRRDR
FT                   APYSDAVTVIVDSMHDHRAAYAFEINAAGVQSDALLFEDDTSTSDWDAVWEGATAALAD
FT                   GWGAELRIPLAALRFSNAPVQTWGFAVKRVVARRHEELLSVHLPRGARGQLARMGSLTG
FT                   LQGLAPVQDLEVAPYTAARLAFRPRVSDVPSPRDADPVGDVGVDVRASLGRALSLQGTV
FT                   NPDFGQVEADEIIQNLSSFEIFFPEKRPFFTQGMDLFQPVALPGRRSPQQLFYSRRIGL
FT                   DAPILGAVKLVGKPTGTLQVGILDALVTGAGSGLPEASPDRSFRLDAAQPFHFGPRSSL
FT                   PELAPAPRNFLAGVARWQPAPGRTLGATVTSTLPLGPGCSISDAEKDDEAEDPRERRPA
FT                   RCDALSGSAAALDWSLRSRDGEWFLLGQVTGSQSLGGAPARAAPGAPVSSPRRTLADGT
FT                   VLDEGELGYGAHAAVGRAGGEPWRFELHWEYESPTLDLNALGYQRTQNEQLGRALVRYV
FT                   RPSGGGPFHTYSVVSGVQGQRTTDGRGLARMKQLWLSAEAQLRSYQWVGCTGVVELRAW
FT                   DVREIEESGVALERPRSTFGECWLSLDPSKAVFLEGGAGMGRSEALGPVQGQRYWGTSG
FT                   VVVVRPHARVESRFDVRYEVSRWGARYVDEPAPGVYRFAGLEAPSLSVTLRQQVVLTPR
FT                   LTLQGYVQLFTSFGEYRAFRQASGVDRKVTLASLSPAEAPGPSENDFREGALNLNAVLR
FT                   WEYRLGSTLYLVYTRAQRELEWDGSAPLASTLRPVALGAGPATDTFLVKWTYYWAR"
     atgatccgac gctcgctcgc gctcctcgcc gccgcgctcg ccccgcccgc cctcgccgcc        60
     gccccgggcg atcccctcac cgccgcccgg cgccagggcg agatcgtcct cgacgggcgg       120
     ctcgaggagc cgggctgggc gctcgccccc gcctacgacg gcttcgtcca gatcttcccc       180
     tccgagggcg ccgcgccctc ggagcgcacc gaggtgcgcg tgctgttcga cgatcgcgcc       240
     ctgtacgtgg ggatcgcggc gcgcgaccgc agcccgggcg aggtgcgcag gccgctcggc       300
     cggcgcgacc gcgcgccgta ctccgacgcg gtgacggtga tcgtggactc gatgcacgat       360
     caccgcgccg cgtacgcctt cgagatcaac gccgccgggg tgcagtcgga cgcgctcctc       420
     ttcgaggacg acacctccac gagcgactgg gacgcggtgt gggagggggc gacggcggcg       480
     ctcgccgacg gctggggggc cgagctgcgc atcccgctcg ccgccctgcg cttctcgaac       540
     gcgccggtgc agacctgggg cttcgcggtg aagcgcgtcg tggcccggcg tcacgaggag       600
     ctcctctccg tgcacctgcc gcgcggcgcc cgcggccagc tcgcgcgcat gggcagcctg       660
     accgggctcc aggggctcgc cccggtgcag gacctcgagg tggcgccgta caccgcggcg       720
     cggctcgcgt tccggccgcg cgtctcggac gttccgagcc cgcgcgacgc cgacccggtc       780
     ggcgacgtcg gcgtggacgt gcgcgcctcg ctcggccgcg cgctgtcgct gcagggcacg       840
     gtcaaccccg acttcgggca ggtcgaggcg gacgagatca tccagaacct ctcctccttc       900
     gagatcttct tcccggagaa gcggcccttc ttcacgcagg ggatggatct gttccagccg       960
     gtcgccctcc cggggcgacg ctctccgcag cagctcttct actcgcgccg catcgggctc      1020
     gacgcgccca tcctcggcgc cgtcaagctc gtcggcaagc cgaccggcac gctgcaggtg      1080
     gggatcctcg acgcgctcgt caccggcgcc ggctccgggc tgcccgaggc gagccccgat      1140
     cgctccttcc gcctggacgc ggcgcagccc ttccacttcg ggccgcgctc gtcgctcccc      1200
     gagctcgccc cggccccgcg gaacttcctc gccggcgtcg cgcgctggca gccggccccg      1260
     gggcgcacgc tcggcgcgac cgtgacctcc acgctgcccc tcggcccggg ctgctcgatc      1320
     tcggacgccg agaaggacga cgaggcggag gacccgcgcg agcgccgccc ggcccgctgc      1380
     gacgcgctct ccgggagcgc cgccgcgctc gactggagcc tgcgctcgcg cgatggggag      1440
     tggttcctgc tcgggcaggt caccggctcg cagtcgctcg gcggcgcccc ggcgcgcgcg      1500
     gcccccggcg cgcccgtgtc ctcgcccagg cgcacgctcg ccgacgggac cgtcctcgac      1560
     gagggcgagc tcggctacgg ggcgcacgcg gcggtcggcc gggccggcgg tgagccctgg      1620
     cgcttcgagc tgcactggga gtacgagtcc cccacgctcg acctcaacgc gctcggctac      1680
     cagcggacgc agaacgagca gctcggccgc gcgctggtgc gctacgtccg cccgagcggc      1740
     ggcggcccct tccacaccta ctcggtcgtc tccggcgtcc aggggcagcg caccaccgac      1800
     ggccgcggcc tcgcccgcat gaagcagctc tggctctccg cggaggcgca gctccgcagc      1860
     taccagtggg tgggctgcac gggcgtcgtg gagctgcggg cctgggacgt ccgcgagatc      1920
     gaggagtccg gcgtcgcgct cgagcggccg cgctcgacct tcggggagtg ctggctctcc      1980
     ctcgacccct ccaaggccgt cttcctcgag ggaggcgccg ggatgggccg ctcggaggcg      2040
     ctcgggccgg tgcagggcca gcgctactgg ggcacgagcg gggtcgtcgt ggtccggccc      2100
     cacgcgcggg tcgagagccg gttcgacgtg cgctacgagg tctcgcggtg gggcgcgcgc      2160
     tacgtggacg agccggcgcc gggcgtgtac cgcttcgcgg ggctcgaggc cccctcgctc      2220
     tccgtcacgc tgcggcagca ggtggtcctc acgccgcgcc tcacgctgca ggggtacgtc      2280
     cagctcttca cctccttcgg cgagtaccgc gcgttccgcc aggcgagcgg cgtggatcgc      2340
     aaggtcacgc tggcctccct ctcccccgcg gaggcgcccg gcccgagcga gaacgacttc      2400
     cgcgagggcg cgctcaacct gaacgcggtg ctgcgctggg aataccggct gggctcgacg      2460
     ctgtacctcg tctacacgag ggcgcagcgc gagctcgagt gggacggctc ggccccgctg      2520
     gccagcacgc tgcgtcccgt cgcgctcggc gccgggccgg ccacggacac cttcctcgtg      2580
     aagtggacct actactgggc tcgctga                                          2607
//

If you have problems or comments...

PBIL Back to PBIL home page