(data stored in ACNUC7421 zone)

EMBL: CP000769.PE104

CP000769.PE104       Location/Qualifiers
FT   CDS_pept        131783..133168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0106"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ade:Adeh_1782
FT                   PAS/PAC sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24324"
FT                   /db_xref="GOA:A7H6H8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H8"
FT                   /protein_id="ABS24324.1"
FT                   /translation="MPAPAGKTGRWFGLPKRVALGFAVAIGSLIASGILTGVTLGKRTD
FT                   ASVAAELAADTQLALEELESAMLVADTALDAYLAGGEARHRARLQRARDKIPGELDHLT
FT                   RAIAAERIDEDGELLGRLRPAVKRMVDALDRAAALADAGGREEARLHRLAEGVPPFDRA
FT                   HAALEAVEEREKSEVARAAAWAHRARIISNGVFLGLDTILLLFVLGAARVVRQEIRARE
FT                   EHEAELARTQAVQQRLVAVVSHDLRNPLSGILTASWALARVSLPDDALRAVRRITAAGR
FT                   RMERLIRDLLDWSRAKAGAEIPVTLLEADLWDVCTRVAEDLCDPRCQRLELARHGDTRA
FT                   EFDPERMEQVVANLVSNALKYGDPDRPVYVEAAGEEGAVRIEVRNEGPPLDSATIAAIF
FT                   EPFHRAPRDHPDSRTSVGLGLFVVRTLTEAQGAEVNVHSSVGQGTTFVVRVRRAVRAEA
FT                   RAG"
     atgccggctc ctgccgggaa gacgggccgt tggttcggac tgccaaagcg cgtcgcgctc        60
     gggttcgccg tggcgatcgg tagcctgatc gcctccggga tcctcaccgg cgtcacgctg       120
     gggaagcgga ccgacgccag cgtcgcggcg gagctggcgg ccgacaccca gctcgcgctc       180
     gaggagctcg agtcggccat gctcgtcgcg gacacggcgc tcgacgcgta cctcgccggg       240
     ggggaggccc gccaccgggc gcgcttgcag cgggcgcgcg acaagatccc cggcgagctg       300
     gatcacctca cccgggccat cgcggcggag cgcatcgacg aggacggcga gctcctgggg       360
     cggctgcgcc cggcggtgaa gcggatggtc gacgcgctgg atcgcgcggc cgccctcgcc       420
     gacgccggcg gccgcgagga agcgcgcctc caccgcctcg ccgagggggt acctccgttc       480
     gaccgggcgc acgcggcgct cgaggcggtc gaggagcgcg agaagagcga ggtcgctcgt       540
     gccgcagcct gggcgcaccg tgcgcgcatc atctcgaacg gggtgttcct cgggctcgac       600
     acgatcctgc tgctgttcgt gctcggggcc gcgcgcgtcg tgcggcagga gatccgcgcc       660
     cgcgaggagc acgaggcgga gctcgcccgg acgcaggcgg tgcagcagcg cctcgtcgcc       720
     gtggtcagcc acgacctgcg gaacccgctc tccggcatcc tgaccgcctc gtgggcgctc       780
     gcccgcgtga gcctccccga cgacgcgctg cgggccgtgc gcaggatcac cgcggcgggc       840
     cggcgcatgg agcggctgat ccgcgacctc ctcgactgga gccgcgcgaa ggccggggcg       900
     gagatcccgg tgaccttgct cgaggccgac ctgtgggacg tctgcacccg cgtcgccgaa       960
     gatctctgcg atccccgctg ccagcggctg gagctcgccc gccacggcga cacccgcgcg      1020
     gagttcgacc cggagcggat ggagcaggtg gtcgcgaacc tcgtctcgaa cgccctcaag      1080
     tacggggacc ccgaccggcc cgtgtacgtg gaggcggcgg gcgaggaggg agcggtccgg      1140
     atcgaggtgc gcaacgaggg accgccgctc gattcggcga ccatcgcggc catcttcgag      1200
     cccttccacc gcgcgccgcg cgaccacccc gactcgagga cgagcgtggg gctcgggctg      1260
     ttcgtcgtgc gcacgctcac cgaggcccag ggcgccgagg tgaacgtcca ctcctcggtc      1320
     gggcagggga ccacgttcgt cgtgagggtg cgacgagccg tccgcgccga ggcgcgggcg      1380
     gggtga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page