(data stored in ACNUC7421 zone)

EMBL: CP000769.PE105

CP000769.PE105       Location/Qualifiers
FT   CDS_pept        133380..134312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24325"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6H9"
FT                   /protein_id="ABS24325.1"
FT                   /translation="MADLQNEFSWSKSRHEKFAECRRAYFYAYYGSWGGWEAAPGTPVR
FT                   ELYVLKKLSSRWQWAGSVVHDALKQMLSRARVTGDFLPLERVLERTRTRARAQFAVSRE
FT                   KSYWREASRIVGLVEHEYGDAVADEDWRRLYEGVVDGSLRAFYASPTFEEIRRTPRERW
FT                   LSVDELDSWEFEGTKIWVAIDFAFRDSDGQVRILDWKTGKERGVDHTQVGIYALYAQRK
FT                   WSAPPDQVLGGLVYLVANGAGAGGETVSVAADPAALERCQSEMRHSIGEMKATLQDPAR
FT                   NHALIDQFPQRAQRESCRRCPFRRPCGRM"
     atggccgatc tccagaacga gttctcctgg tcgaagtccc gccacgagaa gttcgcggaa        60
     tgccggcgcg cgtacttcta cgcgtattac ggcagctggg gggggtggga ggccgcgccc       120
     ggtacgccgg tgcgggagct gtacgtcctg aagaagctct cctcgcgctg gcaatgggcg       180
     ggctcggtcg tgcacgacgc gctgaagcag atgctctctc gcgcgcgggt gacgggcgac       240
     ttcctccccc tggagcgcgt gctcgagcgg acccggacgc gggcgcgggc gcagttcgcg       300
     gtctcgcgcg agaagagcta ctggcgggag gcgtcgcgca tcgtcgggct ggtggagcac       360
     gagtacggcg acgccgtggc ggacgaggac tggcggcggc tctacgaggg cgtcgtcgac       420
     ggctcgctgc gcgcgttcta cgcgagcccc accttcgagg agatccgccg cacgccccgc       480
     gagcgctggc tctcggtgga cgagctcgac tcctgggagt tcgaggggac gaagatctgg       540
     gtggcgatcg acttcgcctt ccgcgactcc gacggccagg tccgcatcct ggactggaag       600
     accggcaagg agcgcggcgt cgatcacacg caggtcggca tctacgcgct ctacgcccag       660
     cgcaagtgga gcgccccgcc cgaccaggtg ctgggcgggc tcgtctacct cgtcgcgaac       720
     ggcgccggcg cgggagggga gacggtgtcg gtggccgccg atcccgccgc gctcgagcgg       780
     tgccagagcg agatgcgcca ctccatcggc gagatgaagg ccacgctcca ggaccccgcg       840
     cgcaaccacg ccctcatcga ccagttcccg cagcgagccc agcgcgagag ctgccgccgc       900
     tgcccgttcc gccgcccgtg cgggcggatg tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page