(data stored in ACNUC7421 zone)

EMBL: CP000769.PE106

CP000769.PE106       Location/Qualifiers
FT   CDS_pept        complement(134395..134703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0108"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; Stress
FT                   responsive alpha-beta barrel domain protein; KEGG:
FT                   cte:CT1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24326"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I0"
FT                   /protein_id="ABS24326.1"
FT                   /translation="MVKHLVFWTLKEQADGASREENARRVKAALEGLAGRIPGLLELEV
FT                   GIDFSRGEASYDVALSSTFADRAALDAYQAHPEHRAVADLIGRVRERRAVVDYETGS"
     atggtgaagc acctcgtgtt ctggacgctg aaggagcagg ccgacggcgc gtcgcgcgag        60
     gagaacgcgc gcagggtgaa ggcggcgctg gaggggctcg cgggccgcat cccgggcctg       120
     ctcgagctcg aggtcgggat cgacttctcg cgcggcgagg cgtcctacga cgtcgcgctc       180
     tcctcgacgt tcgccgatcg cgcggccctc gacgcctacc aggcgcaccc cgagcaccgc       240
     gccgtcgccg acctcatcgg gcgcgtgcgc gagaggcgcg cggtcgtgga ctacgagacg       300
     ggctcctag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page