(data stored in ACNUC7421 zone)

EMBL: CP000769.PE109

CP000769.PE109       Location/Qualifiers
FT   CDS_pept        complement(136726..138219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0111"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: ade:Adeh_0107 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24329"
FT                   /db_xref="GOA:A7H6I3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6I3"
FT                   /protein_id="ABS24329.1"
FT                   /translation="MTLRLKLFVLIAGVIIFAMSGVTAVALWREVVRGQELLAREGVAI
FT                   ASTAATAAAHWVRADGVDPGGASALPAVLERVVASAPLDRAWIVDRTGKVLACVTRTEE
FT                   ACPEGAPPSEFQLAESPLQALGRLLQPEGIVASAPILRSGAVVGAVRVDFTHEEVVGNA
FT                   RNLAWGASIVAAFWIFVGQLLAAIFLRRVTSPLVRLSEAAESLAEERGVRLEEPEEREL
FT                   ADLVRAFNDMSRRLDDRRSENQRLIAELEARVAQKTREVLRADRLATLGGIAAGFAHEI
FT                   GNSLNVIRGYASVAARELPADAEVKSDVEAIRREVTRAAGLIERFLVFARARTVHPIAQ
FT                   PVEPILREAVEVVGPAAAHANVERVVEIAPALPEVVADGELLRQAFLNLCVNAVQAMQE
FT                   RGGGTLVARARREGDGLVVEVSDSGPGLPRDIAAHVFDPFFTTKANGTGLGLAIVRQAA
FT                   EAHGGTVEVESAPGHGATFRIRLPVAPAEPAAAGAGAAP"
     gtgaccctcc ggctcaagct cttcgtgctc atcgcggggg tgatcatctt cgcgatgagc        60
     ggcgtcaccg ccgtggcgct ctggcgcgag gtggtgcgcg ggcaggagct cctggcgcgc       120
     gagggcgtcg ccatcgcctc caccgccgcc accgccgccg cccactgggt ccgcgccgac       180
     ggcgtggacc cgggcggcgc ctccgcgctg ccggcggtgc tcgagcgcgt ggtcgcgagc       240
     gcgccgctcg accgcgcctg gatcgtcgac cggaccggca aggtcctcgc ctgcgtcacg       300
     cgcaccgagg aggcctgccc cgagggcgcc ccgccctcgg agttccagct cgccgagtcc       360
     ccgctccagg cgctcgggcg gctgctccag ccggagggca tcgtggcctc cgctcccatc       420
     ctgcgcagcg gcgccgtggt gggggccgtc cgggtggact tcacgcacga ggaggtggtg       480
     gggaacgccc gcaacctggc gtggggggcg agcatcgtcg ccgccttctg gatcttcgtc       540
     gggcagctcc tcgccgccat cttcctgcgc cgcgtgacga gcccgctcgt gcggctctcc       600
     gaggccgccg agtcgctcgc ggaggagcgc ggcgtccgcc tcgaggagcc cgaggagcgc       660
     gagctcgccg atctggtgcg cgccttcaac gacatgtcgc ggcggctcga cgaccggcgc       720
     agcgagaacc agcggctcat cgccgagctg gaggcgcgcg tcgcgcagaa gacccgcgag       780
     gtgctgcgcg cggaccgcct cgccacgctg ggcggcatcg ccgccggctt cgcccacgag       840
     atcggcaact ccctgaacgt catccgcggc tacgcctcgg tggcggcgcg cgagctgccc       900
     gccgacgccg aggtgaagtc cgacgtggag gcgatccggc gcgaggtcac ccgcgcggcc       960
     gggctgatcg agcggttcct ggtcttcgcg cgcgcgcgca cggtgcaccc catcgcgcag      1020
     cccgtcgagc cgatcctgcg cgaggcggtg gaggtggtcg ggccggccgc ggcgcacgcg      1080
     aacgtcgagc gcgtggtcga gatcgcgccc gcgctgccgg aggtggtggc cgacggcgag      1140
     ctgctccgcc aggccttcct gaacctctgc gtcaacgccg tgcaggcgat gcaggagcgc      1200
     gggggcggga cgctcgtcgc gcgcgcgcgc cgcgagggag acgggctcgt ggtggaggtg      1260
     tcggacagcg gcccgggcct gccgagggac atcgccgccc acgtcttcga cccgttcttc      1320
     accaccaagg cgaacggcac cggcctcggg ctggccatcg tgcgccaggc ggcggaggcc      1380
     cacggcggca cggtggaggt cgagagcgcc cccggccacg gcgccacctt ccgcatccgc      1440
     ctgcccgtcg cgccggccga gccggccgcg gcgggcgcag gcgccgcgcc gtga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page